DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and Ucp4B

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster


Alignment Length:292 Identity:79/292 - (27%)
Similarity:134/292 - (45%) Gaps:42/292 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ASVGAAMVTHPLDLIKVTLQTQ-------------QGHLSVAQLIPKLAREQGVLVFYNGLSASV 67
            ::..|.:|.:|.|:.|..:|.|             :|.|:.|.   .:.||:|:|..|.|:||.:
  Fly    46 SACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAM---GIVREEGLLKLYGGISAML 107

  Fly    68 LRQLTYSTARFGVYE-AGKKYVNTD-------SFGGKVALAGASGLVGGIVGTPADMVNVRMQND 124
            .|...:|..:...|: ..:|.:..|       ||.|.......:|....::..|.:::.::||.:
  Fly   108 FRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASVLTNPTELIKIQMQME 172

  Fly   125 VKLPPQQRR------NYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYL 183
                 .|||      ..:|....|..:||..|...|:.|....|.|..|:|||.::.||..|.:|
  Fly   173 -----GQRRLRGEPPRIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGDVSCYDFCKRFL 232

  Fly   184 LATPYFQDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGE------FNGLWDIVKHTAK- 241
            :|.....||....|.|::.||.....|:.|.||:|:|.||....|      :.|..|.:....: 
  Fly   233 IAEFDLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQGRGIHYKGSLDCLSRLVRE 297

  Fly   242 LGPLGFFKGYVPAFVRLGPHTIITFVFLEQLR 273
            .|.|..:||::|.::|:||.:::.::..||:|
  Fly   298 EGFLAMYKGFIPYWMRVGPASVVFWMTFEQIR 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 23/96 (24%)
PTZ00169 13..273 CDD:240302 78/290 (27%)
Mito_carr 89..184 CDD:278578 27/107 (25%)
Mito_carr 189..278 CDD:278578 28/92 (30%)
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 70/267 (26%)
Mito_carr 32..129 CDD:278578 22/85 (26%)
Mito_carr 138..233 CDD:278578 26/99 (26%)
Mito_carr 246..331 CDD:278578 26/84 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441640
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.