DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and Ucp4A

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster


Alignment Length:294 Identity:81/294 - (27%)
Similarity:140/294 - (47%) Gaps:40/294 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ASVGAAMVTHPLDLIKVTLQTQ---------------QGHLSVAQLIPKLAREQGVLVFYNGLSA 65
            ||: |.:.|:||||.|..||.|               :|.::.|.   .:|||:|.|..:.|::.
  Fly    51 ASI-AELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAF---GIAREEGALKLWQGVTP 111

  Fly    66 SVLRQLTYSTARFGVYEAGKKYVNTDSFGG----KVALAG-ASGLVGGIVGTPADMVNVRMQNDV 125
            ::.|.:.||..|...|:..:|....:....    |.||.| .:|.|...:.:|||:|.|::|.:.
  Fly   112 ALYRHVVYSGVRICSYDLMRKEFTQNGTQALPVWKSALCGVTAGAVAQWLASPADLVKVQIQMEG 176

  Fly   126 KL-----PPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLA 185
            :.     ||:    .::|.....::.::.|.|.|:.|:.....|..|:.:|.:..||..|..::.
  Fly   177 RRRLMGEPPR----VHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYDTIKHLIMN 237

  Fly   186 TPYFQDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGE------FNGLWDIVKHT-AKLG 243
            .....|....|..||:.||.:|..:..|.||:|||.||....|      :.|..|.::.| :|.|
  Fly   238 RLQMPDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMNQPTDENGRGLLYRGSVDCLRQTVSKEG 302

  Fly   244 PLGFFKGYVPAFVRLGPHTIITFVFLEQLRLKFG 277
            .:..:||::|.::|:.|.::..::..||:|...|
  Fly   303 FVALYKGFLPCWIRMAPWSLTFWLSFEQIRKMIG 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 26/90 (29%)
PTZ00169 13..273 CDD:240302 79/288 (27%)
Mito_carr 89..184 CDD:278578 25/104 (24%)
Mito_carr 189..278 CDD:278578 30/96 (31%)
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 80/291 (27%)
Mito_carr 39..138 CDD:278578 26/90 (29%)
Mito_carr 142..239 CDD:278578 25/100 (25%)
Mito_carr 248..336 CDD:278578 28/87 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441652
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.