DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and sesB

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:303 Identity:68/303 - (22%)
Similarity:113/303 - (37%) Gaps:65/303 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GGLASVGAAMVTHPLDLIKVTLQTQQGHLSVAQLIP------------KLAREQGVLVFYNGLSA 65
            ||:::..:.....|::.:|:.||.|  |:| .|:.|            ::.:|||...|:.|..|
  Fly    30 GGISAAVSKTAVAPIERVKLLLQVQ--HIS-KQISPDKQYKGMVDCFIRIPKEQGFSSFWRGNLA 91

  Fly    66 SVLRQLTYSTARFGVYEAGKKYV------NTD---SFGGKVALAGASGLVGGIVGTPADMVNVRM 121
            :|:|........|...:..|:..      ||.   .|.|.:|..||:|........|.|....|:
  Fly    92 NVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRL 156

  Fly   122 QNDVKLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYD--------- 177
            ..|.....|  |.:....:.|.::::.:|...|:.|...:....|:.......|||         
  Fly   157 AADTGKGGQ--REFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTARGMLPDP 219

  Fly   178 -QTKIYLLATPYFQDNLVTHFTASLVAGTIATTLTQPLDVLKTRSM---NAKPGEFNGLWDIVKH 238
             .|.||:            .:..:.|..|:|..::.|.|.::.|.|   ..|..|.     |.|:
  Fly   220 KNTPIYI------------SWAIAQVVTTVAGIVSYPFDTVRRRMMMQSGRKATEV-----IYKN 267

  Fly   239 T-------AKL-GPLGFFKGYVPAFVRLGPHTIITFVFLEQLR 273
            |       ||. |...||||.....:| |.......|..::::
  Fly   268 TLHCWATIAKQEGTGAFFKGAFSNILR-GTGGAFVLVLYDEIK 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 23/99 (23%)
PTZ00169 13..273 CDD:240302 68/301 (23%)
Mito_carr 89..184 CDD:278578 25/107 (23%)
Mito_carr 189..278 CDD:278578 22/96 (23%)
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 21/88 (24%)
PTZ00169 23..312 CDD:240302 68/303 (22%)
Mito_carr 124..220 CDD:278578 20/97 (21%)
Mito_carr 223..312 CDD:278578 24/105 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441935
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.