DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and CG5254

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster


Alignment Length:293 Identity:71/293 - (24%)
Similarity:118/293 - (40%) Gaps:56/293 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GGLASVGAAMVTHPLDLIKVTLQTQ-----------QGHLS-VAQLIPKLAREQGVLVFYNGLSA 65
            ||.|......:..|||::|..:|.|           :.|.: |.....|:.|.:|:..::.|:..
  Fly    21 GGSAGFLEVCIMQPLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCFAKMYRHEGISSYWKGIMP 85

  Fly    66 SVLRQLTYSTARFGVYEAGKKYVNTDSFGGKV------ALAG-ASGLVGGIVGTPADMVNVRMQN 123
            .:|.:......:|.|:|..|...   .||...      :||| .:|.:..|...|.::|.|..|.
  Fly    86 PILAETPKRAIKFLVFEQTKPLF---QFGSPTPTPLTFSLAGLTAGTLEAIAVNPFEVVKVAQQA 147

  Fly   124 DVKLPPQQRRNYNNAFDGLVRVYRQE--GFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLAT 186
            |      :::...:.|.....:.:|:  ||..|..|.||...|..:..:....||...|   ...
  Fly   148 D------RQKKMLSTFAVAKGIIQQDGLGFSGLNKGITATMGRNGVFNMVYFGFYHSVK---NVV 203

  Fly   187 PYFQDN---LVTHFTASLVAGTIATTLTQPLDVLKTRSMNAK--PGEFNGLWDIVKHTAKLGPLG 246
            |.::::   .:...|...:|||:|..:..|.||.|:|....:  ||:       :|:...|..:|
  Fly   204 PEYKESHLEFLRKVTIGFLAGTLACFVNIPFDVAKSRIQGPQPVPGQ-------IKYRGTLSSMG 261

  Fly   247 ----------FFKGYVPAFVRLGP-HTIITFVF 268
                      .:||.||..:|||| ..|:..||
  Fly   262 IVYREEGFRALYKGLVPKIMRLGPGGAILLLVF 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 20/90 (22%)
PTZ00169 13..273 CDD:240302 71/293 (24%)
Mito_carr 89..184 CDD:278578 24/103 (23%)
Mito_carr 189..278 CDD:278578 26/96 (27%)
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 21/93 (23%)
PTZ00169 19..301 CDD:240302 71/293 (24%)
Mito_carr 122..207 CDD:278578 23/93 (25%)
Mito_carr 209..305 CDD:278578 26/93 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441947
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.