DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and SLC25A34

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_997231.1 Gene:SLC25A34 / 284723 HGNCID:27653 Length:304 Species:Homo sapiens


Alignment Length:282 Identity:78/282 - (27%)
Similarity:132/282 - (46%) Gaps:22/282 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GGLASVGAAMVTHPLDLIKVTLQTQQGHLSVAQLIPK-----------LAREQGVLVFYNGLSAS 66
            |..|...|.:.|:||:::|..||. ||.|......|:           :||..|:.....||:|.
Human    13 GASACCLACVFTNPLEVVKTRLQL-QGELQARGTYPRPYHGFIASVAAVARADGLWGLQKGLAAG 76

  Fly    67 VLRQLTYSTARFGVYEAGKKYVNTDSFGGKVALAGASGLVGGIVGTPADMVNVRMQND--VKLPP 129
            :|.|...:..||..|....:...|...||.|.....:|.:|..||:||.::..::|..  ..:..
Human    77 LLYQGLMNGVRFYCYSLACQAGLTQQPGGTVVAGAVAGALGAFVGSPAYLIKTQLQAQTVAAVAV 141

  Fly   130 QQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLATPYF-QDNL 193
            ..:.|:......|..::||:|...|:.|...|..|.::.:..|:|.:...|.::....:. :|:.
Human   142 GHQHNHQTVLGALETIWRQQGLLGLWQGVGGAVPRVMVGSAAQLATFASAKAWVQKQQWLPEDSW 206

  Fly   194 VTHFTASLVAGTIATTLTQPLDVLKTRSMN-----AKPGE-FNGLWD-IVKHTAKLGPLGFFKGY 251
            :......:::......:..|.||:.||..|     |..|: :.||.| :||...:.|||..:||.
Human   207 LVALAGGMISSIAVVVVMTPFDVVSTRLYNQPVDTAGRGQLYGGLTDCMVKIWRQEGPLALYKGL 271

  Fly   252 VPAFVRLGPHTIITFVFLEQLR 273
            .||::|||||||::.:|.::||
Human   272 GPAYLRLGPHTILSMLFWDELR 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 25/89 (28%)
PTZ00169 13..273 CDD:240302 76/280 (27%)
Mito_carr 89..184 CDD:278578 23/96 (24%)
Mito_carr 189..278 CDD:278578 31/93 (33%)
SLC25A34NP_997231.1 Mito_carr 2..91 CDD:278578 23/78 (29%)
Solcar 1 4..97 24/84 (29%)
Solcar 2 101..194 22/92 (24%)
Mito_carr <119..197 CDD:278578 17/77 (22%)
Mito_carr 203..295 CDD:278578 31/91 (34%)
Solcar 3 204..295 31/90 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.