DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and Ucp1

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_036814.1 Gene:Ucp1 / 24860 RGDID:3931 Length:307 Species:Rattus norvegicus


Alignment Length:285 Identity:92/285 - (32%)
Similarity:146/285 - (51%) Gaps:31/285 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FFGGLASVGAAMVTHPLDLIKVTLQTQ-QGHLS-------VAQLIPKLAREQGVLVFYNGLSASV 67
            |..|:::..|.::|.|||..||.||.| :|..|       |...|..||:.:|:...|:||.|.:
  Rat    18 FSAGVSACLADIITFPLDTAKVRLQIQGEGQASSTIRYKGVLGTITTLAKTEGLPKLYSGLPAGI 82

  Fly    68 LRQLTYSTARFGVYEAGKKYVNTD-----SFGGKVALAGASGLVGGIVGTPADMVNVRMQNDVKL 127
            .||:::::.|.|:|:..::|.::.     |.|.|::....:|.|...:|.|.::|.||||....|
  Rat    83 QRQISFASLRIGLYDTVQEYFSSGRETPASLGSKISAGLMTGGVAVFIGQPTEVVKVRMQAQSHL 147

  Fly   128 ---PPQQRRNYNNAFDGLVRVYR----QEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLA 185
               .|:....||        .||    .|....|:.|.|....|.:::...::..||..|..|:.
  Rat   148 HGIKPRYTGTYN--------AYRVIATTESLSTLWKGTTPNLMRNVIINCTELVTYDLMKGALVN 204

  Fly   186 TPYFQDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGEFNGL--WDIVKHTAKLGPLGFF 248
            .....|::..|..::||||...|.|..|:||:|||.:|:.||::..:  ..:..:| |.||..||
  Rat   205 HHILADDVPCHLLSALVAGFCTTLLASPVDVVKTRFINSLPGQYPSVPSCAMTMYT-KEGPAAFF 268

  Fly   249 KGYVPAFVRLGPHTIITFVFLEQLR 273
            ||:.|:|:|||...:|.||..|||:
  Rat   269 KGFAPSFLRLGSWNVIMFVCFEQLK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 29/93 (31%)
PTZ00169 13..273 CDD:240302 90/281 (32%)
Mito_carr 89..184 CDD:278578 26/106 (25%)
Mito_carr 189..278 CDD:278578 36/87 (41%)
Ucp1NP_036814.1 Mito_carr 10..103 CDD:278578 28/84 (33%)
Solcar 1 11..102 28/83 (34%)
PTZ00169 21..297 CDD:240302 91/282 (32%)
Mito_carr 110..205 CDD:278578 27/102 (26%)
Solcar 2 111..201 26/97 (27%)
Solcar 3 210..295 36/85 (42%)
Mito_carr 215..300 CDD:278578 35/80 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.