DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and ucp-4

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_505414.1 Gene:ucp-4 / 179315 WormBaseID:WBGene00006729 Length:324 Species:Caenorhabditis elegans


Alignment Length:296 Identity:86/296 - (29%)
Similarity:138/296 - (46%) Gaps:38/296 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 WFFGGLASVGAAMVTHPLDLIKVTLQTQQGHLS---VAQLIPKLAREQGVLVFYNGLSASVLRQL 71
            :|....|::.|..||:|||:.|..||..:...:   :.|:...:.|.:|.:..:.|::.::.|..
 Worm    27 YFLSCTAALVAETVTYPLDITKTRLQIARNKFTKGGMVQVTYDIIRREGAMALWTGVAPAITRHY 91

  Fly    72 TYSTARFGVYE-----AGKKYVNTDSFGGKVALAGA-SGLVGGIVGTPADMVNVRMQND-VKLPP 129
            .|:..|.|.||     ...|.|.......|..|.|| |||:.....:|.|:|.|:||.: ::...
 Worm    92 IYTGIRMGAYEQIRLLTFNKEVEKSFPLWKSMLCGAFSGLIAQFAASPTDLVKVQMQMEGLRRLQ 156

  Fly   130 QQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLATPYFQDNLV 194
            :|...|..|.|....:||.:||..|:.|......|..|:.:..||.||..|..|:.....:||.:
 Worm   157 KQPLRYTGATDCFRSLYRTQGFFGLWIGWMPNCQRAALLNMADIATYDSVKHGLIDNFELKDNWL 221

  Fly   195 THFTASLVAGTIATTLTQPLDVLKTRSM---------------NAKPGEFNGLWD----IVKHTA 240
            ||..||..||..|..::.|.||:|||.|               |.....:.|:.|    |:|:. 
 Worm   222 THAVASACAGLAAAIVSLPSDVVKTRMMDQIRHELDAKMMHKKNTHVDLYKGVVDCYIKIIKNE- 285

  Fly   241 KLGPLGFF---KGYVPAFVRLGPHTIITFVFLEQLR 273
                 |||   ||::|:::|:.|.::..:|..|::|
 Worm   286 -----GFFSLYKGFLPSYIRMAPWSLTFWVSYEEIR 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 23/89 (26%)
PTZ00169 13..273 CDD:240302 84/291 (29%)
Mito_carr 89..184 CDD:278578 30/96 (31%)
Mito_carr 189..278 CDD:278578 32/107 (30%)
ucp-4NP_505414.1 PTZ00169 20..317 CDD:240302 86/296 (29%)
Mito_carr 22..111 CDD:278578 21/83 (25%)
Mito_carr 115..214 CDD:278578 31/98 (32%)
Mito_carr <240..318 CDD:278578 23/83 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.