DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and ucp3

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_002942565.1 Gene:ucp3 / 100495495 XenbaseID:XB-GENE-6464668 Length:309 Species:Xenopus tropicalis


Alignment Length:280 Identity:96/280 - (34%)
Similarity:143/280 - (51%) Gaps:18/280 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FFG-GLASVGAAMVTHPLDLIKVTLQTQQGHLSVAQ-----------LIPKLAREQGVLVFYNGL 63
            |.| |.|:..|.:.|.|||..||.||.|....||..           .|..:.:.:|....||||
 Frog    17 FVGAGTAACIADLFTFPLDTAKVRLQIQGEGTSVKDTKVLRYKGVFGTIKTMVKTEGATSLYNGL 81

  Fly    64 SASVLRQLTYSTARFGVYEAGKKYVNTDSFGGKVA---LAG-ASGLVGGIVGTPADMVNVRMQND 124
            .|.:.||:::::.|.|:|::.|::....|....||   ||| .:|.:...:..|.|:|.||.|..
 Frog    82 VAGLQRQMSFASIRIGLYDSVKQFYCRQSESSGVACRLLAGCTTGAMAVTLAQPTDVVKVRFQAH 146

  Fly   125 VKLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLATPYF 189
            :|:...:|| ||...|....:.::||.:.|:.|..|...|..::...::..||..|..:|.....
 Frog   147 IKVMDGERR-YNGTVDAYKTIAKEEGLRGLWKGTIANITRNAIVNCAELVTYDLIKETILNQRLM 210

  Fly   190 QDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGEF-NGLWDIVKHTAKLGPLGFFKGYVP 253
            .|||..||.|:..||..||.:..|:||:|||.||:..|:: |.|........|.|.:.|:||::|
 Frog   211 TDNLPCHFVAAFGAGFCATVVASPVDVVKTRYMNSPAGQYKNALNCAFIMLVKEGSVAFYKGFMP 275

  Fly   254 AFVRLGPHTIITFVFLEQLR 273
            ||:|||...|:.||..|||:
 Frog   276 AFLRLGSWNIVMFVSYEQLK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 29/92 (32%)
PTZ00169 13..273 CDD:240302 94/276 (34%)
Mito_carr 89..184 CDD:278578 28/98 (29%)
Mito_carr 189..278 CDD:278578 38/86 (44%)
ucp3XP_002942565.1 PTZ00169 14..299 CDD:240302 96/280 (34%)
Mito_carr 111..206 CDD:395101 27/95 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.