DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and ucp1

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001107354.1 Gene:ucp1 / 100135179 XenbaseID:XB-GENE-963773 Length:309 Species:Xenopus tropicalis


Alignment Length:279 Identity:89/279 - (31%)
Similarity:136/279 - (48%) Gaps:23/279 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GLASVGAAMVTHPLDLIKVTLQTQ---------QG--HLSVAQLIPKLAREQGVLVFYNGLSASV 67
            |.|:..|.:.|.|||..||.||.|         .|  :..|...|..:.:.:|....||||.|.:
 Frog    21 GTAACIADLFTFPLDTAKVRLQIQGETTGSGAANGIRYKGVFGTISTIVKTEGPKSLYNGLVAGL 85

  Fly    68 LRQLTYSTARFGVYEAGKKYVNTD----SFGGKVALAGASGLVGGIVGTPADMVNVRMQNDVKLP 128
            .||:::::.|.|:|:..|.:....    ..|.::.....:|.:...|..|.|:|.||.|....|.
 Frog    86 QRQMSFASIRIGLYDTVKLFYTNGKEKAGIGSRILAGCTTGALAVTVAQPTDVVKVRFQAQANLQ 150

  Fly   129 PQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLATPYFQDNL 193
            ..:|| ||...|....:.::||.:.|:.|......|..::...::..||..|..||......|||
 Frog   151 GVKRR-YNGTMDAYKTIAKKEGVRGLWKGTFPNVTRNAIVNCTELVTYDVIKENLLHYKLMTDNL 214

  Fly   194 VTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGEF----NGLWDIVKHTAKLGPLGFFKGYVPA 254
            ..||.::..||...|.:..|:||:|||.||:.||::    |..|.::   .|.||..|:||:||:
 Frog   215 PCHFVSAFGAGFCTTVIASPVDVVKTRYMNSPPGQYKSALNCAWTMI---TKEGPTAFYKGFVPS 276

  Fly   255 FVRLGPHTIITFVFLEQLR 273
            |:|||...::.||..|||:
 Frog   277 FLRLGSWNVVMFVSYEQLK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 27/92 (29%)
PTZ00169 13..273 CDD:240302 88/277 (32%)
Mito_carr 89..184 CDD:278578 23/98 (23%)
Mito_carr 189..278 CDD:278578 37/89 (42%)
ucp1NP_001107354.1 Mito_carr 10..110 CDD:278578 27/88 (31%)
PTZ00169 14..299 CDD:240302 89/279 (32%)
Mito_carr 111..208 CDD:278578 25/97 (26%)
Mito_carr 211..302 CDD:278578 37/88 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.