DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PK2-R1 and CCKBR

DIOPT Version :9

Sequence 1:NP_731790.1 Gene:PK2-R1 / 41639 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001350481.1 Gene:CCKBR / 887 HGNCID:1571 Length:516 Species:Homo sapiens


Alignment Length:472 Identity:99/472 - (20%)
Similarity:162/472 - (34%) Gaps:178/472 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 NGTNASTMAADSP-----VDESLTLRTALTVCYALIFVAGVLGNLITCIVISRNNFMHTATNFYL 146
            |.::...::.:.|     ....|.|...:|: ||:||:..|.||::..:|:..:..:.|.||.:|
Human    30 NSSSVGNLSCEPPRIRGAGTRELELAIRITL-YAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFL 93

  Fly   147 FNLAVSDLILLVSGIPQELYNLWYPDM---YPFTDAMCIMGSVLSEMAANATVLTITAFTVERYI 208
            .:||||||:|.|:.:|..|    .|::   :.|...:|...|.|..::.:.:.|::.|..:|||.
Human    94 LSLAVSDLLLAVACMPFTL----LPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALERYS 154

  Fly   209 AICHPFRQHTMSKLSRAIKFIFAIWLAAFLLALP------------------------------- 242
            |||.|.:.......|.|.:.|.|.||.:.||.:|                               
Human   155 AICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWS 219

  Fly   243 --------------QAMQFSVV----YQNEGYSCTMENDFYAHVFAVSGFIFFGGP--------- 280
                          .|:.:.::    |....:....::|..:.|....|.....||         
Human   220 VLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGGAGPREQNLGEAE 284

  Fly   281 -----------------------------------------------MTA--ICVLYV------- 289
                                                           :||  :|...|       
Human   285 LWRATGPAGVGGTEMKVRVRRKLEMELSWERRSGGDWAGDWGDSPFSLTAHPLCSGAVHQNGRCR 349

  Fly   290 ----LIG-------VKLKRSRLLQSLPRRTF--------DANRGLNAQGRVIRMLVAVAVAFFLC 335
                .:|       |:|.|||....|...|.        .....|.|:.||:|||:.:.|.||||
Human   350 PETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLC 414

  Fly   336 WAPFH------------AQRLMAVYGLNLINIGISRDAFNDYFRILDYTSGVLYFLSTCINPLLY 388
            |.|.:            |.|.::...::.|::                    |.:.|.|:|||:|
Human   415 WLPVYSANTWRAFDGPGAHRALSGAPISFIHL--------------------LSYASACVNPLVY 459

  Fly   389 NIMSHKFREAFKITLTR 405
            ..|..:||:|...|..|
Human   460 CFMHRRFRQACLETCAR 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 44/130 (34%)
7tm_1 124..388 CDD:278431 82/411 (20%)
CCKBRNP_001350481.1 7tm_GPCRs 55..470 CDD:333717 92/439 (21%)
TM helix 1 57..81 CDD:320095 9/24 (38%)
TM helix 2 90..112 CDD:320095 11/21 (52%)
TM helix 3 128..150 CDD:320095 4/21 (19%)
TM helix 4 173..189 CDD:320095 6/15 (40%)
TM helix 5 216..239 CDD:320095 1/22 (5%)
TM helix 6 398..423 CDD:320095 12/24 (50%)
TM helix 7 438..463 CDD:320095 8/44 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.