DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PK2-R1 and gpr39

DIOPT Version :9

Sequence 1:NP_731790.1 Gene:PK2-R1 / 41639 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_956711.1 Gene:gpr39 / 791773 ZFINID:ZDB-GENE-040426-1395 Length:440 Species:Danio rerio


Alignment Length:441 Identity:123/441 - (27%)
Similarity:197/441 - (44%) Gaps:102/441 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 VDESLTLRTALTVCYALIFVAGVLGNLIT---CIVISRNNFMHTATNFYLFNLAVSDLILLVSGI 161
            ::.|..|:..|||.|.||...|||||..|   ..|:.||.::..:...::.:||.|||::|:.|:
Zfish    13 LEPSYGLKVFLTVLYCLILSLGVLGNSATIHVAQVLQRNGYLQRSVAEHMVSLACSDLLVLLIGL 77

  Fly   162 PQELYN-LWYPDMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQHTMSKLSRA 225
            |.|||: :|:|.:....||.|.:.:.|.|:.:.||:|.:...::|||:|||||||...: :..|.
Zfish    78 PVELYSAIWFPFLSRSGDAACRIYNFLFELCSYATILNVATLSLERYLAICHPFRYRAL-RGGRT 141

  Fly   226 IKFIFAIWLAAFLLALPQAMQFSVVYQNEGY-------------SCTMENDFYAHVFAVSGFIFF 277
            .:.:.|.||.:.|:|||    ..|....|||             .||..:..:. ::..|.|..|
Zfish   142 RRLLLAAWLCSALVALP----LLVATGTEGYVPAGRQTPVQNLTFCTSLSQHWV-MYRTSIFTAF 201

  Fly   278 GGPMTAICVLYVLI--GVKL--KRSRLLQSLPRRTFDAN----------RGLNAQGRVIRMLVAV 328
                    |||:|:  ||..  :...|:...|....:|.          ||..::.:.|..||.:
Zfish   202 --------VLYLLVLAGVAFMCRAMILVLRAPMGPAEAGASGDHKHQSARGKASRKQTILFLVLI 258

  Fly   329 AVAFFLCWAPFHAQRLMAV----------YGLNLINIGISRDAFNDYFRILDYTSGVLYFLSTCI 383
            ..|.|:||.|...:|||..          |..:.|.:....|:|              ::||:.:
Zfish   259 VCALFVCWMPNQIRRLMTAAVPKSSWTGSYLTSYIKLHPVADSF--------------FYLSSVL 309

  Fly   384 NPLLYNIMSHKFREAFKITLTRQFGLARNHHHQQSQHHQHNYSALLRQNGSMRLQPASCSVNNNA 448
            ||:|||:.|.:||.||..||..:..|            ||.....|..:|:.:       .:||.
Zfish   310 NPMLYNLSSRQFRSAFLQTLLCRLSL------------QHANRRTLENSGASK-------SSNNT 355

  Fly   449 LEPYGSYRVVQFRCRDANHQLSLQDSIRTTTTTT-----TINSNSMAAGNG 494
            |.|     ::|   |..| ::.:..|.|:|..::     ::|:.....|.|
Zfish   356 LRP-----LLQ---RSLN-RIRMATSSRSTPPSSAERRDSLNTTDRPQGEG 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 49/131 (37%)
7tm_1 124..388 CDD:278431 84/304 (28%)
gpr39NP_956711.1 7tm_1 37..314 CDD:278431 84/304 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.