DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PK2-R1 and Gpr39

DIOPT Version :9

Sequence 1:NP_731790.1 Gene:PK2-R1 / 41639 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_081953.2 Gene:Gpr39 / 71111 MGIID:1918361 Length:456 Species:Mus musculus


Alignment Length:416 Identity:106/416 - (25%)
Similarity:184/416 - (44%) Gaps:73/416 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LGSTNGTN--ASTMAADSPVDE---SLTLRTALTVCYALIFVAGVLGNLIT---CIVISRNNFMH 139
            :.|::|:|  .|.:...|.|.|   :..::..|.:.|.:|||.|:|||.:|   ..|:.:..::.
Mouse     1 MASSSGSNHICSRVIDHSHVPEFEVATWIKITLILVYLIIFVVGILGNSVTIRVTQVLQKKGYLQ 65

  Fly   140 TATNFYLFNLAVSDLILLVSGIPQELYN-LWYPDMYPFTDAMCIMGSVLSEMAANATVLTITAFT 203
            .....::.:||.||:::.:.|:|.|.|: :|.|...|.....|.:.:.|.|..:.||:|.:...:
Mouse    66 KEVTDHMVSLACSDILVFLIGMPMEFYSIIWNPLTTPSYALSCKLHTFLFETCSYATLLHVLTLS 130

  Fly   204 VERYIAICHPFRQHTMSKLSRAIKFIFA-IWLAAFLLALPQAMQFSVVY------QNEGYSC--- 258
            .||||||||||:...:|. .|.:|.:.. :|:.:.|:|||......:.|      .::|.:|   
Mouse   131 FERYIAICHPFKYKAVSG-PRQVKLLIGFVWVTSALVALPLLFAMGIEYPLVNVPTHKGLNCNLS 194

  Fly   259 -TMEND-------------------FYAHVF-AVSGFIFFGGPMTAICVLYVLIGVKLKRSRLLQ 302
             |..:|                   |.:.:| |.:.::.....:..:|...:.:.:|.|:..|..
Mouse   195 RTRHHDEPGNSNMSICTNLSNRWEVFQSSIFGAFAVYLVVLASVAFMCWNMMKVLMKSKQGTLAG 259

  Fly   303 SLPR---RTFDANRGLNAQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLNLINIGISRDAFND 364
            :.|:   |..::.....|:.:.|..|..:.|...:||.|...:|:||.       .....|....
Mouse   260 TGPQLQLRKSESEESRTARRQTIIFLRLIVVTLAVCWMPNQIRRIMAA-------AKPKHDWTRT 317

  Fly   365 YFR---ILDYTSGVLYFLSTCINPLLYNIMSHKFREAF-KITLTRQFGLARNHHHQQSQHHQHNY 425
            |||   ||...|...::||:.:||||||:.|.:||:.| ::...|   |...|.:|:.:......
Mouse   318 YFRAYMILLPFSDTFFYLSSVVNPLLYNVSSQQFRKVFWQVLCCR---LTLQHANQEKRQRARFI 379

  Fly   426 S---------------ALLRQNGSMR 436
            |               |..|.|.|.|
Mouse   380 STKDSTSSARSPLIFLASRRSNSSSR 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 43/132 (33%)
7tm_1 124..388 CDD:278431 75/304 (25%)
Gpr39NP_081953.2 7tm_1 47..344 CDD:278431 75/304 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..456
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.