DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PK2-R1 and Ntsr2

DIOPT Version :9

Sequence 1:NP_731790.1 Gene:PK2-R1 / 41639 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_073186.1 Gene:Ntsr2 / 64636 RGDID:70962 Length:416 Species:Rattus norvegicus


Alignment Length:354 Identity:96/354 - (27%)
Similarity:161/354 - (45%) Gaps:63/354 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 VDESLTLRTALTVCYALIFVAGVLGNLITC-IVISRNNFMHTATNFYLFNLAVSDLILLVSGIPQ 163
            ||..|..:...|..|:|||..|..||.::. :|:...........:::.:||:|.|:||:..:|.
  Rat    25 VDTRLWAKVLFTALYSLIFAFGTAGNALSVHVVLKARAGRPGRLRYHVLSLALSALLLLLVSMPM 89

  Fly   164 ELYN-LW--YPDMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQHTMSKLSRA 225
            |||| :|  ||  :.|.|..|.....:.|:.|.||||::.:.:.||.:|:|.|.|...:....|.
  Rat    90 ELYNFVWSHYP--WVFGDLGCRGYYFVRELCAYATVLSVASLSAERCLAVCQPLRARRLLTPRRT 152

  Fly   226 IKFIFAIWLAAFLLALPQAMQFSVVYQNEGYS---------CT-MENDFYAHVF-AVSGFIFFGG 279
            .:.:..:|:|:..||||.|:.....::.|...         || :.:.....|| .|:..:.|..
  Rat   153 RRLLSLVWVASLGLALPMAVIMGQKHEVESADGEPEPASRVCTVLVSRATLQVFIQVNVLVSFAL 217

  Fly   280 P------MTAICV--LYVLIGVKLKRSRLLQSLP-----------------RRTF---------- 309
            |      :..|.|  |..|.......|..:.|:|                 |:|.          
  Rat   218 PLALTAFLNGITVNHLMALYSQVPSASAQVSSIPSRLELLSEEGLLGFITWRKTLSLGVQASLVR 282

  Fly   310 --DAN--RGLNAQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLNLINIGISRDAFNDYFRILD 370
              ||:  |.|....:|:|.:|||   :.:||.|:||:|||..|   :.:.|.:.:.: |::....
  Rat   283 HKDASQIRSLQHSAQVLRAIVAV---YVICWLPYHARRLMYCY---IPDDGWTNELY-DFYHYFY 340

  Fly   371 YTSGVLYFLSTCINPLLYNIMSHKFREAF 399
            ..:..|:::|:.:.|:|||.:|..||:.|
  Rat   341 MVTNTLFYVSSAVTPILYNAVSSSFRKLF 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 42/131 (32%)
7tm_1 124..388 CDD:278431 80/317 (25%)
Ntsr2NP_073186.1 7tm_1 87..358 CDD:278431 71/279 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24243
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.