DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PK2-R1 and nmur3

DIOPT Version :9

Sequence 1:NP_731790.1 Gene:PK2-R1 / 41639 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:XP_009304366.1 Gene:nmur3 / 566750 ZFINID:ZDB-GENE-130530-567 Length:392 Species:Danio rerio


Alignment Length:307 Identity:107/307 - (34%)
Similarity:169/307 - (55%) Gaps:24/307 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 LTVCYALIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSDLILLVSGIPQELYNLW--YPD 172
            :|..|.|||:.||||||:||.||:::..|.|.||.|||:||:|||::|:.|:|.|:|.||  || 
Zfish    60 VTCTYILIFMTGVLGNLLTCAVITKDRKMQTPTNLYLFSLAISDLLVLLFGMPLEIYELWQNYP- 123

  Fly   173 MYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAIKFIFAIWLAAF 237
             :||.:::|.....|.|....|:||.:|..:||||||:.||.:.........|.:.|..:|..:.
Zfish   124 -FPFGESICCFKIFLFETVCFASVLNVTVLSVERYIAVIHPLKTRYAITNKHARRVIAGVWAMSL 187

  Fly   238 LLALPQAMQFSVVYQ------NEGYSCTMEND--FYAHVFAVSGFIFFGGPMTAICVLYVLIGV- 293
            |.|:|......:.||      .|..:|.:...  .|..|..::..:|:..||..|.|||::||: 
Zfish   188 LCAVPNTSLHGLQYQYLPERVQESATCNLLKPKWMYNLVIQITTVLFYFVPMMMISVLYLMIGLT 252

  Fly   294 -----KLKRSRLLQSLPRRTFDANRGLNAQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLNLI 353
                 |.|:.:|..:....::..:.....:.:|.:|...|.:.|.:||||||..||:..:     
Zfish   253 LGRGQKQKKDKLGSNHSNDSWKIHLDSRRRRQVTKMHFVVVLVFAICWAPFHIDRLLWSF----- 312

  Fly   354 NIGISRDAFNDYFRILDYTSGVLYFLSTCINPLLYNIMSHKFREAFK 400
             |....|..::.|..:...||||::||:.:||::||::|.:|||.|:
Zfish   313 -ITSWTDHMHNIFEYVHIISGVLFYLSSAVNPIIYNLLSSRFRERFQ 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 57/129 (44%)
7tm_1 124..388 CDD:278431 92/279 (33%)
nmur3XP_009304366.1 7tm_4 64..364 CDD:304433 106/303 (35%)
7tm_1 74..346 CDD:278431 92/279 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578489
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6488
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X673
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.