DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PK2-R1 and NTSR1

DIOPT Version :9

Sequence 1:NP_731790.1 Gene:PK2-R1 / 41639 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_002522.2 Gene:NTSR1 / 4923 HGNCID:8039 Length:418 Species:Homo sapiens


Alignment Length:362 Identity:116/362 - (32%)
Similarity:176/362 - (48%) Gaps:60/362 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 GSTNGTNASTMAADSP-----VDESLTLRTALTVCYALIFVAGVLGNLITCIVISRN---NFMHT 140
            |:.:| |||.....:|     |:..:..:..:|..|..:||.|.:||.:|...::|.   ..:.:
Human    36 GNASG-NASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVTAFTLARKKSLQSLQS 99

  Fly   141 ATNFYLFNLAVSDLILLVSGIPQELYN-LWYPDMYPFTDAMCIMGSVLSEMAANATVLTITAFTV 204
            ..:::|.:||:|||:.|:..:|.|||| :|....:.|.||.|.....|.:....||.|.:.:.:|
Human   100 TVHYHLGSLALSDLLTLLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSV 164

  Fly   205 ERYIAICHPFRQHTMSKLSRAIKFIFAIWLAAFLLALPQAMQFSVVYQNE--------GYSC--T 259
            |||:||||||:..|:...||..|||.|||||:.|||:|  |.|::..||.        |..|  |
Human   165 ERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAVP--MLFTMGEQNRSADGQHAGGLVCTPT 227

  Fly   260 MENDFYAHVFAVSGFIFFGGPMTAICVLYVLIGVKL------------------KRSRLLQSL-P 305
            :.......|..|:.|:.|..||..|.||..:|..||                  :.|....:: |
Human   228 IHTATVKVVIQVNTFMSFIFPMVVISVLNTIIANKLTVMVRQAAEQGQVCTVGGEHSTFSMAIEP 292

  Fly   306 RRTFDANRGLNAQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLNLINIGISRDAFN----DYF 366
            .|......|       :|:|.||.:||.:||.|:|.:|||..|        ||.:.:.    |::
Human   293 GRVQALRHG-------VRVLRAVVIAFVVCWLPYHVRRLMFCY--------ISDEQWTPFLYDFY 342

  Fly   367 RILDYTSGVLYFLSTCINPLLYNIMSHKFREAFKITL 403
            ......:..|:::|:.|||:|||::|..||..|..||
Human   343 HYFYMVTNALFYVSSTINPILYNLVSANFRHIFLATL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 53/131 (40%)
7tm_1 124..388 CDD:278431 95/300 (32%)
NTSR1NP_002522.2 7tm_1 80..364 CDD:278431 95/300 (32%)
7tm_4 <159..381 CDD:304433 79/238 (33%)
Neurotensin binding. /evidence=ECO:0000250 321..344 7/30 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.