DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PK2-R1 and ETHR

DIOPT Version :9

Sequence 1:NP_731790.1 Gene:PK2-R1 / 41639 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001287439.1 Gene:ETHR / 42523 FlyBaseID:FBgn0038874 Length:471 Species:Drosophila melanogaster


Alignment Length:396 Identity:109/396 - (27%)
Similarity:179/396 - (45%) Gaps:62/396 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 TALTVCYALIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSDLILLVSGIPQELYNL-WYP 171
            ||:..| .:|.:.||:||::..|||.:...|..:||.:|.||:::||::|:...|..|..: ..|
  Fly    12 TAMFFC-IVIMLLGVVGNVMVPIVIVKTKDMRNSTNIFLTNLSIADLLVLLVCTPTVLVEVNTRP 75

  Fly   172 DMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAIKFIFAIWLAA 236
            :.:.....||.....:....|:|:||||.|.:.|||.|||.|.:...:....|||......|..|
  Fly    76 ETWVLGHEMCKAVPFVELTVAHASVLTILAISFERYYAICEPLKAGYVCTKGRAILICVLAWGIA 140

  Fly   237 FLLALP--QAMQFSVVYQNEGYS---CTME--NDFYAHVFAVSGFIFFGGPMTAICVLYVLIGVK 294
            .|...|  ...::.:....:|.|   |..:  :|:....|.::..:||..|...:.|||.:|...
  Fly   141 ALFTSPILWVAEYKLAEYIDGSSVAVCLTQAISDWTLAFFLMTISVFFVVPFVTLVVLYGIIARN 205

  Fly   295 L--KRSRLLQSLPRRTFDANRGLNAQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLN--LINI 355
            |  .|:.:|::.|.:   ....|.|:.:|:.||.||.::||:|..||....|..:...:  |.::
  Fly   206 LVSNRAAMLRARPTK---PELSLKARKQVVLMLGAVVLSFFVCLLPFRVLTLWIILSTDQTLHDL 267

  Fly   356 GISRDAFNDYFRILDYTSGVLYFLSTCINPLLYNIMSHKFREAFKITLTRQFGLARNHHHQQSQH 420
            |:.|     |:.:| |...::.:|::.:||:|||:||.|||..||                    
  Fly   268 GLVR-----YYSLL-YFCRIMLYLNSAMNPILYNLMSTKFRRGFK-------------------- 306

  Fly   421 HQHNYSALLRQNGSMRLQPASCSVNNNALEPYGSYRVVQFRCRDANHQLSLQDSIRTTTTTTTIN 485
                  .|.:..|.:.|:..:..            |..:...|.....|||  .:.|.|.|.|.:
  Fly   307 ------RLCQDAGRLLLELVTLG------------RRKEDSSRGRRGTLSL--GMGTNTNTNTNS 351

  Fly   486 SNSMAA 491
            ||:..|
  Fly   352 SNATGA 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 42/128 (33%)
7tm_1 124..388 CDD:278431 78/275 (28%)
ETHRNP_001287439.1 7tm_4 18..>143 CDD:304433 41/124 (33%)
7tm_1 27..294 CDD:278431 78/275 (28%)
7tm_4 <102..307 CDD:304433 65/239 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445872
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24243
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5416
SonicParanoid 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.