DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PK2-R1 and PK1-R

DIOPT Version :9

Sequence 1:NP_731790.1 Gene:PK2-R1 / 41639 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001014620.1 Gene:PK1-R / 41713 FlyBaseID:FBgn0038201 Length:430 Species:Drosophila melanogaster


Alignment Length:374 Identity:180/374 - (48%)
Similarity:225/374 - (60%) Gaps:66/374 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 NASTMAAD-SPVDESLTLRTALTVCYALIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSD 153
            :|..|:.| .|..:.|.:...:||.|:|||:.||:||:.|||||.:|..||||||:|||:||:||
  Fly     2 SAGNMSHDLGPPRDPLAIVIPVTVVYSLIFITGVVGNISTCIVIKKNRSMHTATNYYLFSLAISD 66

  Fly   154 LILLVSGIPQELYNLW--YPDMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQ 216
            .:||:||:|||:..:|  ||  |.|.:.:||...:|:|.:|||||||||||||||||||||||..
  Fly    67 FLLLLSGVPQEVSYIWSKYP--YVFGEYICIGRGLLAETSANATVLTITAFTVERYIAICHPFLG 129

  Fly   217 HTMSKLSRAIKFIFAIWLAAFLLALPQAMQFSVVYQNEGYSCTMENDFYAHVFAVSGFIFFGGPM 281
            ..||||||||:.|..:|:.|.:.|:|||.||.:.:.:....|.:......|.|.:|.||||..||
  Fly   130 QAMSKLSRAIRIIVLVWIMAIVTAIPQAAQFGIEHYSGVEQCGIVRVIVKHSFQLSTFIFFLAPM 194

  Fly   282 TAICVLYVLIGVKLKRSRL------------LQSLPRRT-------------------------- 308
            :.|.|||:||||.|.||.|            |:|:|..|                          
  Fly   195 SIILVLYLLIGVHLYRSTLVEGPASVARRQQLKSVPSDTILYRYGGSGTAMSFNGGGSGAGTAGL 259

  Fly   309 -------FDANRG-LNAQG--RVIRMLVAVAVAFFLCWAPFHAQRLMAVY----GLNLINIGISR 359
                   ..:.|| ||..|  ||:||||||.|.|||||||||||||:|:|    |..|      |
  Fly   260 MGGSGAQLSSVRGRLNHYGTRRVLRMLVAVVVCFFLCWAPFHAQRLIAIYAPARGAKL------R 318

  Fly   360 DAFNDYFRILDYTSGVLYFLSTCINPLLYNIMSHKFREAFKITLTRQFG 408
            |.....:.::.|.|||||:||||||||||||||||||||||..|   ||
  Fly   319 DQHEFVYTVMTYVSGVLYYLSTCINPLLYNIMSHKFREAFKAVL---FG 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 78/129 (60%)
7tm_1 124..388 CDD:278431 150/317 (47%)
PK1-RNP_001014620.1 7tmA_capaR 21..358 CDD:320262 169/344 (49%)
TM helix 1 21..48 CDD:320262 15/26 (58%)
TM helix 2 55..81 CDD:320262 16/25 (64%)
TM helix 3 94..124 CDD:320262 22/29 (76%)
TM helix 4 136..158 CDD:320262 10/21 (48%)
TM helix 5 178..207 CDD:320262 16/28 (57%)
TM helix 6 277..307 CDD:320262 23/29 (79%)
TM helix 7 326..351 CDD:320262 18/24 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445866
Domainoid 1 1.000 184 1.000 Domainoid score I3341
eggNOG 1 0.900 - - E33208_3BGH7
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I2906
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6488
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24243
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5416
SonicParanoid 1 1.000 - - X673
109.930

Return to query results.
Submit another query.