DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PK2-R1 and CCHa2-R

DIOPT Version :9

Sequence 1:NP_731790.1 Gene:PK2-R1 / 41639 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001356958.1 Gene:CCHa2-R / 35535 FlyBaseID:FBgn0033058 Length:501 Species:Drosophila melanogaster


Alignment Length:518 Identity:132/518 - (25%)
Similarity:217/518 - (41%) Gaps:115/518 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 GTNASTMAADSP----VDESLTLRTALTVCYALIFVAGVLGNLITCIVISRNNFMHTATNFYLFN 148
            |.|||......|    :|...|.  .:||.|.|||:.|||||....|:..|:..|....|.|:.:
  Fly    48 GHNASADGGIVPYVPVLDRPETY--IVTVLYTLIFIVGVLGNGTLVIIFFRHRSMRNIPNTYILS 110

  Fly   149 LAVSDLILLVSGIPQELYNLWYPDMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHP 213
            ||::||::::..:|.... ::..:.:||...||.:.....:::...:|.|:||.:.|||.||.:|
  Fly   111 LALADLLVILVCVPVATI-VYTQESWPFERNMCRISEFFKDISIGVSVFTLTALSGERYCAIVNP 174

  Fly   214 FRQHTMSKLSRAIKFIFA---IWLAAFLLALPQAMQFSVVYQNEGYSCT----------MENDFY 265
            .|     ||......:|.   ||:.|.||.:|..: ||.:.....::.|          ..:..|
  Fly   175 LR-----KLQTKPLTVFTAVMIWILAILLGMPSVL-FSDIKSYPVFTATGNMTIEVCSPFRDPEY 233

  Fly   266 AHVFAVSG--FIFFGGPMTAICVLYVLIGVKLKRSRLLQSLP--RRTFDANRGLNAQGRVIRMLV 326
            |. |.|:|  .:::..|::.|..||:::..:|..|  .:::|  :::..:.....|:..|.||:|
  Fly   234 AK-FMVAGKALVYYLLPLSIIGALYIMMAKRLHMS--ARNMPGEQQSMQSRTQARARLHVARMVV 295

  Fly   327 AVAVAFFLCWAPFHAQRLMAVYGLNLINIGISRDAFNDYFRILDYTSGVLYFLSTCINPLLYNIM 391
            |..|.||:|:.|:|      |:.|.......:.:.|::::.:|........||::|:||:....:
  Fly   296 AFVVVFFICFFPYH------VFELWYHFYPTAEEDFDEFWNVLRIVGFCTSFLNSCVNPVALYCV 354

  Fly   392 SHKFREAFK-----ITLTRQFGLARNHHHQQSQHHQHNYSALLRQNGSMRLQPASCSVNNNALEP 451
            |..||:.|.     |.:.||..|           .||:.:..:..|.|:.....|..|...|   
  Fly   355 SGVFRQHFNRYLCCICVKRQPHL-----------RQHSTATGMMDNTSVMSMRRSTYVGGTA--- 405

  Fly   452 YGSYRVVQFRCRDANHQLSLQDSIRTTTTTTTINSNSMAAGNGVGGGAGGGGGGRRLRKQEL--- 513
             |:.|....  |::||.:.                   .||.|||||.|.|..|...|:..:   
  Fly   406 -GNLRASLH--RNSNHGVG-------------------GAGGGVGGGVGSGRVGSFHRQDSMPLQ 448

  Fly   514 ----YGPGPGTAVPHRMLQAQVSQLSSLGDANSLLEAEVVDRHYASGRAKRALLATKSGALLV 572
                :|.|.|            ...|.||               |.||. .|:...: |.|:|
  Fly   449 HGNAHGGGAG------------GGSSGLG---------------AGGRT-AAVSEKRXGTLIV 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 42/130 (32%)
7tm_1 124..388 CDD:278431 72/280 (26%)
CCHa2-RNP_001356958.1 7tmA_Bombesin_R-like 70..362 CDD:320593 84/309 (27%)
TM helix 1 71..97 CDD:320593 12/25 (48%)
TM helix 2 104..130 CDD:320593 7/26 (27%)
TM helix 3 142..172 CDD:320593 9/29 (31%)
TM helix 4 182..202 CDD:320593 6/19 (32%)
TM helix 5 234..259 CDD:320593 8/25 (32%)
TM helix 6 285..315 CDD:320593 14/35 (40%)
TM helix 7 330..355 CDD:320593 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438990
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.