DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PK2-R1 and Gpr39

DIOPT Version :9

Sequence 1:NP_731790.1 Gene:PK2-R1 / 41639 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001107864.1 Gene:Gpr39 / 288995 RGDID:1306745 Length:456 Species:Rattus norvegicus


Alignment Length:400 Identity:103/400 - (25%)
Similarity:182/400 - (45%) Gaps:56/400 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LLGSTNGTNASTMAAD-SPVDE---SLTLRTALTVCYALIFVAGVLGNLIT---CIVISRNNFMH 139
            :..|:..:|..:...| |.|.|   :..::..||:.|.::||.|:|||.:|   ..|:.:..::.
  Rat     1 MASSSGSSNICSRVIDHSHVPEFEVATWIKITLTLVYLIVFVVGILGNSVTIRVTQVLQKKGYLQ 65

  Fly   140 TATNFYLFNLAVSDLILLVSGIPQELYN-LWYPDMYPFTDAMCIMGSVLSEMAANATVLTITAFT 203
            .....::.:||.||:::.:.|:|.|.|: :|.|...|.....|.:.:.|.|..:.||:|.:...:
  Rat    66 KEVTDHMISLACSDILVFLIGMPMEFYSIIWNPLTTPSYALSCKLHTFLFETCSYATLLHVLTLS 130

  Fly   204 VERYIAICHPFRQHTMSKLSRAIKFIFAIWLAAFLLALPQAMQFSVVY------QNEGYSC---- 258
            .|||||||||||...:|...:....|..:|:.:.|:|||......:.|      .::|.:|    
  Rat   131 FERYIAICHPFRYKDVSGPCQVKLLIGFVWVTSALVALPLLFAMGIEYPLANVPTHKGLNCNLSR 195

  Fly   259 TMEND-------------------FYAHVF-AVSGFIFFGGPMTAICVLYVLIGVKLKRSRLLQS 303
            |..:|                   |.:.:| |.:.::.....:..:|...:.:.:|.||..|..:
  Rat   196 TRHHDHPGDSNMSICTNLSSRWEVFQSSIFGAFAVYLVVLVSVAFMCWNMMKVLMKSKRGTLAGT 260

  Fly   304 LPR---RTFDANRGLNAQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLNLINIGISRDAFNDY 365
            .|:   |..::.....|:.:.|..|..:.|...:||.|...:|:||.       .....|....|
  Rat   261 GPQLQLRKSESEESRTARRQTIIFLRLIVVTLAVCWMPNQIRRIMAA-------AKPKHDWTKSY 318

  Fly   366 FR---ILDYTSGVLYFLSTCINPLLYNIMSHKFREAF-KITLTRQFGLARNHHHQQSQHHQHNYS 426
            |:   ||...|...::||:.:||||||:.|.:||:.| ::...|   |...|.:|:.|...: :|
  Rat   319 FKAYMILLPFSDTFFYLSSVVNPLLYNVSSQQFRKVFWQVLCCR---LTLQHANQEKQQRAY-FS 379

  Fly   427 ALLRQNGSMR 436
            :....:.|.|
  Rat   380 STKNSSRSAR 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 42/131 (32%)
7tm_1 124..388 CDD:278431 75/303 (25%)
Gpr39NP_001107864.1 7tm_1 47..344 CDD:278431 75/303 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.