DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PK2-R1 and Cckbr

DIOPT Version :9

Sequence 1:NP_731790.1 Gene:PK2-R1 / 41639 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_031653.1 Gene:Cckbr / 12426 MGIID:99479 Length:453 Species:Mus musculus


Alignment Length:462 Identity:117/462 - (25%)
Similarity:178/462 - (38%) Gaps:147/462 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QSPSIGVGIGIASSTMANPSESPEMLLLKNDKFLTHVAHLLNITTE-NLSNLLGSTNGTNASTMA 95
            |.|..|.|     |::..|..|                 |||.::. |||.......||....: 
Mouse    11 QGPGPGSG-----SSLCRPGVS-----------------LLNSSSAGNLSCETPRIRGTGTREL- 52

  Fly    96 ADSPVDESLTLRTALTVCYALIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSDLILLVSG 160
                   .||:|..|   ||:||:..|.||::..:|:..:..:.|.||.:|.:||||||:|.|:.
Mouse    53 -------ELTIRITL---YAVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVAC 107

  Fly   161 IPQELYNLWYPDM---YPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQHTMSKL 222
            :|..|    .|::   :.|...:|...|.|..::.:.:.|.:.|..:|||.|||.|.:.......
Mouse   108 MPFTL----LPNLMGTFIFGTVICKAVSYLMGVSVSVSTLNLAAIALERYSAICRPLQARVWQTR 168

  Fly   223 SRAIKFIFAIWLAAFLLALPQAMQFSVVYQNEG---YSC--TMENDFYAHVFAVSGFI-FFGGPM 281
            |.|.:.|.|.||.:.||.:|..: ::|| |..|   ..|  ...::....:::|...| .|..|.
Mouse   169 SHAARVILATWLLSGLLMVPYPV-YTVV-QPVGPRILQCMHLWPSERVQQMWSVLLLILLFFIPG 231

  Fly   282 TAICVLYVLIG------------------------------------------------------ 292
            ..:.|.|.||.                                                      
Mouse   232 VVMAVAYGLISRELYLGLRFDGDNDSETQSRVRNQGGLPGGAAAPGPVHQNGGCRHVTSLTGEDS 296

  Fly   293 ----VKLKRSRL-LQSLPRRTFDANRG-------LNAQGRVIRMLVAVAVAFFLCWAPFH----- 340
                |:|.|||| :.:|...|.....|       |.|:.||:|||:.:.:.||:||.|.:     
Mouse   297 DGCYVQLPRSRLEMTTLTTPTTGPGPGPRPNQAKLLAKKRVVRMLLVIVLLFFVCWLPVYSANTW 361

  Fly   341 -------AQRLMAVYGLNLINIGISRDAFNDYFRILDYTSGVLYFLSTCINPLLYNIMSHKFREA 398
                   |:|.:|...::.|:             :|.||       |.|.|||:|..|..:||:|
Mouse   362 RAFDGPGARRALAGAPISFIH-------------LLSYT-------SACANPLVYCFMHRRFRQA 406

  Fly   399 FKITLTR 405
            ...|..|
Mouse   407 CLDTCAR 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 44/130 (34%)
7tm_1 124..388 CDD:278431 86/350 (25%)
CckbrNP_031653.1 7tm_4 60..>191 CDD:304433 46/137 (34%)
7tm_1 71..396 CDD:278431 86/350 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..276 0/18 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.