DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PK2-R1 and LOC108648264

DIOPT Version :9

Sequence 1:NP_731790.1 Gene:PK2-R1 / 41639 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:XP_017951879.1 Gene:LOC108648264 / 108648264 -ID:- Length:351 Species:Xenopus tropicalis


Alignment Length:367 Identity:117/367 - (31%)
Similarity:166/367 - (45%) Gaps:53/367 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 NITTENLSNLLGSTNGTNASTMAADSPVDESLTLRTALTVCYALIFVAGVLGNLITCIVISRNNF 137
            |.|||::.:|.                   .:.:...:|:....:|:.|:.|||:|.||..|...
 Frog    15 NYTTEDMDSLF-------------------HIYVLVPVTILCISLFLLGITGNLLTIIVFKRYRD 60

  Fly   138 MHTATNFYLFNLAVSDLILLVSGIPQELYNLWYPDMYPFTDAMCIMGSVLSEMAANATVLTITAF 202
            |.:..|.||.::|||| ||:..|:|.:||.:|....|.|.:.:|.....|||.....|:|.||..
 Frog    61 MRSTVNMYLSSMAVSD-ILIFLGLPSDLYRIWKYKPYAFGNFVCKFLVYLSESCTYCTILHITMV 124

  Fly   203 TVERYIAICHPFRQHTMSKLSRAIKFIFAIWLAAFLLALPQAMQFSVVY-----QNEGYSC---- 258
            ::|||||||.|.:...:....|....|..:|:.|.|.|.|....|.|.:     ..|...|    
 Frog   125 SIERYIAICFPLKAKIIITKRRVKIVIILLWIFALLTASPILFLFGVEHPPGFQPEETKECKYTE 189

  Fly   259 -TMENDFYAHVFAVSGFIFFGGPMTAICVLYVLIGVKLKRSRLLQSLPRRTFDANRGLNAQGRVI 322
             :.:|.. .||......|:|..||..:..||.||..||.::|   ...|....|||| ......:
 Frog   190 QSAQNGL-LHVMTWVSTIYFFLPMFFLTFLYGLICRKLWQTR---HWARGPATANRG-KYNKATV 249

  Fly   323 RMLVAVAVAFFLCWAPFHAQRLMAVYGLNLINIGISRDAF---NDYFRILDYTSGVLYFLSTCIN 384
            :||..|.|.|.|||.|||..|::....      |:....|   ..||.:|   |.||::||..||
 Frog   250 KMLAVVVVCFMLCWLPFHIGRILFALA------GVGEYVFFEVTQYFNLL---SMVLFYLSASIN 305

  Fly   385 PLLYNIMSHKFREAFKITLTRQFGLARNHHHQQSQHHQHNYS 426
            |:||||||.|:|.|.:..|..:.||      |..:...:.:|
 Frog   306 PMLYNIMSEKYRSAMRRMLYPKQGL------QSGRTRSYRFS 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 48/127 (38%)
7tm_1 124..388 CDD:278431 95/276 (34%)
LOC108648264XP_017951879.1 7tm_GPCRs 31..319 CDD:391938 106/302 (35%)
TM helix 1 33..57 CDD:341315 9/23 (39%)
TM helix 2 66..87 CDD:341315 11/21 (52%)
TM helix 3 104..126 CDD:341315 7/21 (33%)
TM helix 4 149..165 CDD:341315 5/15 (33%)
TM helix 5 197..220 CDD:341315 7/22 (32%)
TM helix 6 246..271 CDD:341315 11/24 (46%)
TM helix 7 288..313 CDD:341315 15/27 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.