DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PK2-R1 and NMUR1

DIOPT Version :9

Sequence 1:NP_731790.1 Gene:PK2-R1 / 41639 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_006047.3 Gene:NMUR1 / 10316 HGNCID:4518 Length:426 Species:Homo sapiens


Alignment Length:367 Identity:125/367 - (34%)
Similarity:191/367 - (52%) Gaps:57/367 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 DESLTLR--------TALTVC--YALIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSDLI 155
            ||:|.|:        ..:.:|  |.||||.|.:||.:||:||.|:..|.|.||:|||:||||||:
Human    44 DEALRLKYLGPQQTELFMPICATYLLIFVVGAVGNGLTCLVILRHKAMRTPTNYYLFSLAVSDLL 108

  Fly   156 LLVSGIPQELYNLWYPDMYPFTDAM--CIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQHT 218
            :|:.|:|.|||.:|:  .|||...:  |...::|.||...|:||.:||.:||||:|:.||.:..:
Human   109 VLLVGLPLELYEMWH--NYPFLLGVGGCYFRTLLFEMVCLASVLNVTALSVERYVAVVHPLQARS 171

  Fly   219 MSKLSRAIKFIFAIWLAAFLLALPQA-----MQFSVVYQN---EGYSCTM--ENDFYAHVFAVSG 273
            |...:...:.:.|:|..|.|.:||..     .|..|..:.   :...|.:  ....|..|...:.
Human   172 MVTRAHVRRVLGAVWGLAMLCSLPNTSLHGIRQLHVPCRGPVPDSAVCMLVRPRALYNMVVQTTA 236

  Fly   274 FIFFGGPMTAICVLYVLIGVKLKRSRLL---------QSLPRRTFDANRGLNAQGR--VIRMLVA 327
            .:||..||..:.|||:|||::|:|.|||         .:..|..:......:.:||  |.:||..
Human   237 LLFFCLPMAIMSVLYLLIGLRLRRERLLLMQEAKGRGSAAARSRYTCRLQQHDRGRRQVTKMLFV 301

  Fly   328 VAVAFFLCWAPFHAQRLM-AVY-----GLNLINIGISRDAFNDYFRILDYTSGVLYFLSTCINPL 386
            :.|.|.:|||||||.|:| :|.     ||:|.            |:.:...||:.::|.:..||:
Human   302 LVVVFGICWAPFHADRVMWSVVSQWTDGLHLA------------FQHVHVISGIFFYLGSAANPV 354

  Fly   387 LYNIMSHKFREAFKITLTRQFGLARNHHHQQSQHHQHNYSAL 428
            ||::||.:|||.|:..|.    |....|..:.:|..|:.|.:
Human   355 LYSLMSSRFRETFQEALC----LGACCHRLRPRHSSHSLSRM 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 57/129 (44%)
7tm_1 124..388 CDD:278431 100/292 (34%)
NMUR1NP_006047.3 7tm_1 77..356 CDD:278431 100/292 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145170
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BGH7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8501
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24243
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5416
SonicParanoid 1 1.000 - - X673
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.