DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PK2-R1 and ghsrb

DIOPT Version :9

Sequence 1:NP_731790.1 Gene:PK2-R1 / 41639 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:XP_002666717.1 Gene:ghsrb / 100332193 ZFINID:ZDB-GENE-090327-1 Length:365 Species:Danio rerio


Alignment Length:342 Identity:113/342 - (33%)
Similarity:175/342 - (51%) Gaps:41/342 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 TNGTNAS------TMAADSPVDESLT-------------LRTALTVCYALIFVAGVLGNLITCIV 131
            ||.||.|      |:.|::.:|.:.|             :.|.:||..:.:|:.|:.|||:|.:|
Zfish     2 TNWTNVSICPLSITLCAENIMDSNATSEDEYPVHLFPVPILTGITVTCSFLFLVGIAGNLLTILV 66

  Fly   132 ISRNNFMHTATNFYLFNLAVSDLILLVSGIPQELYNLWYPDMYPFTDAMCIMGSVLSEMAANATV 196
            :::...|.|.||.||.::|:|||::.:. :|.:||.:|....:.|.|.:|.:...:||....:|:
Zfish    67 VTKYKDMRTTTNLYLCSMALSDLLIFLC-MPLDLYRVWRYRPWNFGDELCKLFQFVSESCTYSTI 130

  Fly   197 LTITAFTVERYIAICHPFRQHTMSKLSRAIKFIFAIWLAAFLLALPQAMQFSVVYQNEGYSCTME 261
            |.|||.:||||.|||.|.|...:....|....|..:|..|...|.|..:...|.::| |.:....
Zfish   131 LNITALSVERYFAICFPLRAKVIVTRGRVKGVILLLWTVALCSAGPIFILVGVEHEN-GTNAWET 194

  Fly   262 NDFYAHVFAV-SGF---------IFFGGPMTAICVLYVLIGVKLKRSRLLQSLPRRTFDANRGLN 316
            |:..|..:|: ||.         :||..|:..:.|||.|||.:|.|.:.....|..:.|.:   |
Zfish   195 NECKATEYAIRSGLLTMMVWVSSVFFFLPVLCLTVLYSLIGRRLWRRKENPVGPISSRDKS---N 256

  Fly   317 AQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLNLINIGISRDAFNDYFRILDYTSGVLYFLST 381
            .|  .::||..|.:||.|||.|||..|.:........:..||:  .::|..::.:   ||::||.
Zfish   257 KQ--TVKMLAVVVLAFVLCWLPFHVGRYLVSKSSEANSPVISQ--ISEYCNLVSF---VLFYLSA 314

  Fly   382 CINPLLYNIMSHKFREA 398
            .|||:||||||.|||.|
Zfish   315 AINPILYNIMSKKFRSA 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 45/127 (35%)
7tm_1 124..388 CDD:278431 89/273 (33%)
ghsrbXP_002666717.1 7tm_4 55..339 CDD:304433 100/289 (35%)
7tm_1 59..321 CDD:278431 89/273 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.