DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PK2-R2 and NMUR2

DIOPT Version :9

Sequence 1:NP_731788.1 Gene:PK2-R2 / 41638 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_064552.3 Gene:NMUR2 / 56923 HGNCID:16454 Length:415 Species:Homo sapiens


Alignment Length:309 Identity:112/309 - (36%)
Similarity:178/309 - (57%) Gaps:38/309 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LSVGYALIFIAGVLGNLITCIVISRNNFMHTATNFYLFNLAISDMILLCSGMPQDLYNLWHPDNY 133
            :||.|..||:.||:||::.|:||.::..|.|.||:|||:||:||:::|..|||.::|.:|.  ||
Human    48 VSVVYVPIFVVGVIGNVLVCLVILQHQAMKTPTNYYLFSLAVSDLLVLLLGMPLEVYEMWR--NY 110

  Fly   134 P--FSDSICILESVLSETAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAVKFIFAIWIAAL 196
            |  |....|..::.|.||...|::|:||..:||||:||.||||....|...||::.:..:|..::
Human   111 PFLFGPVGCYFKTALFETVCFASILSITTVSVERYVAILHPFRAKLQSTRRRALRILGIVWGFSV 175

  Fly   197 LLALP----QAIQFSVVMQGM----GTSCTMKNDFFAH--VFAVSGFLFFGGPMTAICVLYVLIG 251
            |.:||    ..|:|.....|.    ..:||:....:.:  :..|:.|||:..|||.|.|||.|:.
Human   176 LFSLPNTSIHGIKFHYFPNGSLVPGSATCTVIKPMWIYNFIIQVTSFLFYLLPMTVISVLYYLMA 240

  Fly   252 VKLKRSRLLQA------LPRRCYDVNRGISAQTRVIRMLVAVAVAFFICWAPFHAQRLMAVYGST 310
            ::||:.:.|:|      :.|.|         :..|.:||..:.:.|.|||||||..||.     .
Human   241 LRLKKDKSLEADEGNANIQRPC---------RKSVNKMLFVLVLVFAICWAPFHIDRLF-----F 291

  Fly   311 SGIESQWFND---VFSILDYTSGVLYFLSTCINPLLYNIMSHKFREAFK 356
            |.:| :|...   ||:::...|||.::||:.:||::||::|.:|:.||:
Human   292 SFVE-EWSESLAAVFNLVHVVSGVFFYLSSAVNPIIYNLLSRRFQAAFQ 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 99/281 (35%)
NMUR2NP_064552.3 7tm_1 62..327 CDD:278431 99/281 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145173
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BGH7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8501
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24243
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5416
SonicParanoid 1 1.000 - - X673
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.