DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PK2-R2 and CapaR

DIOPT Version :9

Sequence 1:NP_731788.1 Gene:PK2-R2 / 41638 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_996140.1 Gene:CapaR / 40393 FlyBaseID:FBgn0037100 Length:477 Species:Drosophila melanogaster


Alignment Length:374 Identity:132/374 - (35%)
Similarity:201/374 - (53%) Gaps:51/374 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PEELLPTVT-PMT-PLSLLATLSVGYALIFIAGVLGNLITCIVISRNNFMHTATNFYLFNLAISD 112
            |:|.:..|. |.| ||.....:::.:..|||.||:|||:.||||.|::.||||||:|||:||:||
  Fly    50 PKEFVAFVLGPQTLPLYKAVLITIIFGGIFITGVVGNLLVCIVIIRHSAMHTATNYYLFSLAVSD 114

  Fly   113 MILLCSGMPQDLYNLWHPDNYP--FSDSICILESVLSETAANATVLTITAFTVERYIAICHPFRQ 175
            ::.|..|:|.:::..||  .||  |....|.:.:.:||.....:|.||.||::||::|||||...
  Fly   115 LLYLLFGLPTEVFLYWH--QYPDLFGMPFCKIRAFISEACTYVSVFTIVAFSMERFLAICHPLHL 177

  Fly   176 HTMSKLSRAVKFIFAIWIAALLLALP-------QAIQFSVVMQGMGTS--CTMK----NDFFAHV 227
            :.|....||::.|.|:||.:.:.|:|       |.:.:.:....:..|  |:|.    |:.  .|
  Fly   178 YAMVGFKRAIRIITALWIVSFISAIPFGLLSDIQYLNYPLDHSRIEESAFCSMSPKIVNEI--PV 240

  Fly   228 FAVSGFLFFGGPMTAICVLYVLIGVKLKRSRLLQALPRRCYDVNRGI-SAQTR--------VIRM 283
            |.||..:||..||..|.:||..:|.|: |||..|.|     .|.:|. :.:||        ||||
  Fly   241 FEVSFCIFFVIPMILIILLYGRMGAKI-RSRTNQKL-----GVQQGTNNRETRNSQMRKKTVIRM 299

  Fly   284 LVAVAVAFFICWAPFHAQRLMAVYGSTSGIESQWFNDVFSILDYTSGVLYFLSTCINPLLYNIMS 348
            |.||.:.||:||.|||.|||:.:|..    ....:.|:...|...:|..|::|..:||::|::||
  Fly   300 LAAVVITFFVCWFPFHLQRLIFLYAK----NMDNYLDINEALFSIAGFAYYVSCTVNPIVYSVMS 360

  Fly   349 HKFREAFKVTLARHFGLGGKNQG----RGLPHTYSALRRNQTGSLRLHT 393
            .::|.||:..|.      ||..|    .|....:|:.|.:.... |:|:
  Fly   361 RRYRVAFRELLC------GKAVGAYYNSGFARDHSSFRESSAYD-RVHS 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 105/284 (37%)
CapaRNP_996140.1 7tm_4 85..374 CDD:304433 112/308 (36%)
7tm_1 85..356 CDD:278431 105/284 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445869
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BGH7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24243
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5416
SonicParanoid 1 1.000 - - X673
76.880

Return to query results.
Submit another query.