DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PK2-R2 and OR10G7

DIOPT Version :9

Sequence 1:NP_731788.1 Gene:PK2-R2 / 41638 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001004463.1 Gene:OR10G7 / 390265 HGNCID:14842 Length:311 Species:Homo sapiens


Alignment Length:339 Identity:76/339 - (22%)
Similarity:124/339 - (36%) Gaps:65/339 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SADNLTS-LLQGLEPEELLPTVTPMTPLSLLATLSVGYALIFIAGVLGNLITCIVISRNNFMHTA 100
            :|..||: :|.||          |..| .|.|.|...:.::::..|||||:..:||..::.:||.
Human     3 NATLLTAFILTGL----------PHAP-GLDAPLFGIFLVVYVLTVLGNLLILLVIRVDSHLHTP 56

  Fly   101 TNFYLFNLAISDMILLCSGMPQDLYNLWHPDNYPFSDSICILESVLSETAANATVLTITAFTVER 165
            ..::|.||:..||......:|:.|..|..|.....|...|:.:........:......|..:.:|
Human    57 MYYFLTNLSFIDMWFSTVTVPKMLMTLVSPSGRTISFHSCVAQLYFFHFLGSTECFLYTVMSYDR 121

  Fly   166 YIAICHPFRQHTMSKLSRAVKFIFAIWIAALLLALPQAI-QFSVVMQG--------------MGT 215
            |:||.:|.|...|.............|::..|.:..|.| .|.:...|              :..
Human   122 YLAISYPLRYTNMMTGRSCALLATGTWLSGSLHSAVQTILTFHLPYCGPNQIQHYFCDAPPILKL 186

  Fly   216 SC--TMKNDFFAHVFAVSGFLFFGGPMTAICVLYVLIGVKLKRSRLLQALPRRCYDVNRGISAQT 278
            :|  |..|:.   |..|:..|...|....|.:.||.|...:.|.|..:...|         :.||
Human   187 ACADTSANEM---VIFVNIGLVASGCFVLIVLSYVSIVCSILRIRTSEGRHR---------AFQT 239

  Fly   279 RVIRMLVAVAV---AFFICWAPFHAQRLMAVYGSTSGIESQWFNDVFSILDYTSGVLYFLSTCIN 340
            .....:|.:..   ..||...|.....|..|..            ||    ||:     |:...|
Human   240 CASHCIVVLCFFGPGLFIYLRPGSRDALHGVVA------------VF----YTT-----LTPLFN 283

  Fly   341 PLLYNIMSHKFREA 354
            |::|.:.:.:.::|
Human   284 PVVYTLRNKEVKKA 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 61/280 (22%)
OR10G7NP_001004463.1 7tm_4 29..301 CDD:304433 65/302 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7505
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.