DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PK2-R2 and CCHa1-R

DIOPT Version :9

Sequence 1:NP_731788.1 Gene:PK2-R2 / 41638 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster


Alignment Length:425 Identity:110/425 - (25%)
Similarity:185/425 - (43%) Gaps:50/425 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ELLPTVTPMTPLSL---LATLSVGYALIFIAGVLGNLITCIVISRNNFMHTATNFYLFNLAISDM 113
            ||:.|.||..|...   ...:.:.:||||:.|||||....:|......|....|.|:.:||::|:
  Fly    64 ELVTTETPYVPYGRRPETYIVPILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALADL 128

  Fly   114 ILLCSGMP--QDLYNLWHPDNYPFSDSICILESVLSETAANATVLTITAFTVERYIAICHPFRQ- 175
            :::.:.:|  ..:|.:   :.:|:...:|.|...:.:.:...:|.|:||.:.:||.||..|.|: 
  Fly   129 LVIITTVPLASTVYTV---EYWPYGSFLCSLSEFMKDVSIGVSVFTLTALSGDRYFAIVDPLRKF 190

  Fly   176 HTMSKLSRAVKFIFA----IWIAALLLALPQAIQFSVVMQGMGTS----CTMKNDFFAHVFAVSG 232
            |......||.:...|    ||:.|:|..||..|..::...|:...    |....:.:...:|.|.
  Fly   191 HAHGGGRRATRMTLATAVSIWLLAILCGLPALIGSNLKHLGINEKSIVICYPYPEEWGINYAKSM 255

  Fly   233 FL-----FFGGPMTAICVLYVLIGVKLKRSRLLQALPRRCYDVNRGISAQTRVIRMLVAVAVAFF 292
            .|     ::..|:..|.|.||||.:.|..|   .::|.......|.:.|:.:|...::|..|.|.
  Fly   256 VLLHFLVYYAIPLVVIAVFYVLIALHLMYS---ASVPGEIQGAVRQVRARRKVAVTVLAFVVIFG 317

  Fly   293 ICWAPFHAQRLMAVYGSTSGIESQWFNDVFSILDYTSGVLYFLSTCINPLLYNIMSHKFREAFKV 357
            ||:.|:|...|...:..|:..:...|..|..|:.|   .:.|.::|.||:....:|..||:.|. 
  Fly   318 ICFLPYHVFFLWFYFWPTAQDDYNAFWHVLRIVAY---CMSFANSCANPVALYFVSGAFRKHFN- 378

  Fly   358 TLARHF---GLGGKNQGRGLPHTYSALR---RNQTGSLRLHTTDS-----VRTTMTSMATTTTGL 411
               |:.   |..|:.:.||...|:...|   ...|.|.|..:..|     :|:......|.||..
  Fly   379 ---RYLFCRGASGRRKKRGQHDTFCMHRDTSLTSTASKRFQSRHSCYQSTIRSCRLQETTITTLP 440

  Fly   412 NGSANGSGNGTTTGQSVRLNRVSLDSVQMQGQNRS 446
            ||       |...|.::....::|..:|..|.|.:
  Fly   441 NG-------GNQNGANISAVELALPVLQAPGHNEA 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 70/276 (25%)
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 30/102 (29%)
7tm_1 98..364 CDD:278431 69/274 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438993
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.