DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PK2-R2 and Ntsr1

DIOPT Version :9

Sequence 1:NP_731788.1 Gene:PK2-R2 / 41638 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001102437.1 Gene:Ntsr1 / 366274 RGDID:1306076 Length:424 Species:Rattus norvegicus


Alignment Length:377 Identity:117/377 - (31%)
Similarity:183/377 - (48%) Gaps:72/377 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 YALIFIAGVLGNLITCIVISRN---NFMHTATNFYLFNLAISDMILLCSGMPQDLYN-LW--HPD 131
            |..:|:.|.:||.:|...::|.   ..:.:..:::|.:||:||:::|...||.:||| :|  || 
  Rat    71 YLALFVVGTVGNSVTAFTLARKKSLQSLQSTVHYHLGSLALSDLLILLLAMPVELYNFIWVHHP- 134

  Fly   132 NYPFSDSICILESVLSETAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAVKFIFAIWIAAL 196
             :.|.|:.|.....|.:....||.|.:.:.:||||:||||||:..|:...||..|||.|||:|:.
  Rat   135 -WAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASA 198

  Fly   197 LLALPQAIQFSVVMQ---GMGTS-----CT--MKNDFFAHVFAVSGFLFFGGPMTAICVLYVLIG 251
            |||:|  :.|::.:|   |.||.     ||  :.......|..|:.|:.|..||..|.:|..:|.
  Rat   199 LLAIP--MLFTMGLQNRSGDGTHPGGLVCTPIVDTATVKVVIQVNTFMSFLFPMLVISILNTVIA 261

  Fly   252 VKL--------KRSRL---------------LQALPRRCYDVNRGISAQTRVIRMLVAVAVAFFI 293
            .||        ::.|:               :...|.|...:..|       :.:|.||.:||.:
  Rat   262 NKLTVMVHQAAEQGRVCTVGTHNGLEHSTFNMTIEPGRVQALRHG-------VLVLRAVVIAFVV 319

  Fly   294 CWAPFHAQRLMAVYGSTSGIESQWFNDVFSILDY---TSGVLYFLSTCINPLLYNIMSHKFREAF 355
            ||.|:|.:|||..|.|    :.||...:|....|   .:..|:::|:.|||:|||::|..||:.|
  Rat   320 CWLPYHVRRLMFCYIS----DEQWTTFLFDFYHYFYMLTNALFYVSSAINPILYNLVSANFRQVF 380

  Fly   356 KVTLA------RHFGLGGKNQGRGLPHTYSALRRNQTGSLRLHTTDSVRTTM 401
            ..|||      ||        .|....|:|. :.|...|....:|.:.|.|:
  Rat   381 LSTLACLCPGWRH--------RRKKRPTFSR-KPNSMSSNHAFSTSATRETL 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 94/302 (31%)
Ntsr1NP_001102437.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
7tm_1 81..369 CDD:278431 94/302 (31%)
Neurotensin binding 326..349 8/26 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..424 7/28 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24243
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.