DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32473 and RNPEPL1

DIOPT Version :9

Sequence 1:NP_731787.1 Gene:CG32473 / 41636 FlyBaseID:FBgn0052473 Length:1025 Species:Drosophila melanogaster
Sequence 2:NP_060696.4 Gene:RNPEPL1 / 57140 HGNCID:10079 Length:725 Species:Homo sapiens


Alignment Length:636 Identity:144/636 - (22%)
Similarity:237/636 - (37%) Gaps:167/636 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 PAVKAASKVLQNLGFRLPKQIKPSKYRLHLRPDLERKNYSGNISISLQVLEP---IAFIPVHVKQ 189
            ||:..||.....| |||    :..:..|.|||  |.:..:|.:.:.|..|.|   ...:..| ..
Human    26 PALDVASASSAQL-FRL----RHLQLGLELRP--EARELAGCLVLELCALRPAPRALVLDAH-PA 82

  Fly   190 LNVSTVEVKRLDESGA------------------------------------------PLKDITP 212
            |.:.:...:|...:.|                                          |..|...
Human    83 LRLHSAAFRRAPAAAAETPCAFAFSAPGPGPAPPPPLPAFPEAPGSEPACCPLAFRVDPFTDYGS 147

  Fly   213 TLTFAHPEFEYWVTEFEQPLEAGNYSLLLNFTGSLVDRITGMYQSSYLDK--LKNRSRSIISTKF 275
            :||...|.    ..:..||     :.::|.:|.:....|.      :||.  ....::..:.|:.
Human   148 SLTVTLPP----ELQAHQP-----FQVILRYTSTDAPAIW------WLDPELTYGCAKPFVFTQG 197

  Fly   276 EPTYARQAFPCFDEPALKAQFTITVARPSGDEYHVLSNMPVASEYVDGDITEVTFAETVPMSTYL 340
            .....|..|||||.||:|..::..|..|||  ..||.: ...|.|::.: ....|....|:..||
Human   198 HSVCNRSFFPCFDTPAVKCTYSAVVKAPSG--VQVLMS-ATRSAYMEEE-GVFHFHMEHPVPAYL 258

  Fly   341 AAFVVSDFQYKETTVEGTSIALKVYAPPAQVEKTQYALDTAAGVMAYYINYFNVSYALPKLDLVA 405
            .|.|..|.  |...:...|   :|:|.|..:......|..|..............|...:.|:|.
Human   259 VALVAGDL--KPADIGPRS---RVWAEPCLLPTATSKLSGAVEQWLSAAERLYGPYMWGRYDIVF 318

  Fly   406 I-PDFVSGAMENWGLVTFRETALLYDESTSSSVNKQRVAIVVAHELAHQWFGNLVTMNWWNDLWL 469
            : |.|...|||| ..:||..:::|..:        :.:.|.|.||:||.||||.||...|.::||
Human   319 LPPSFPIVAMEN-PCLTFIISSILESD--------EFLVIDVIHEVAHSWFGNAVTNATWEEMWL 374

  Fly   470 NEGFASFLEYKGVKQMHPE--WDMDNQFVIEELH----------PVLTIDATLASHPIVKSIESP 522
            :||.|::.:.:...:.:..  ..::..|.::.||          ||..:...|  .|.|    :|
Human   375 SEGLATYAQRRITTETYGAAFTCLETAFRLDALHRQMKLLGEDSPVSKLQVKL--EPGV----NP 433

  Fly   523 AEITEYFDTITYSKGAALVRMLENLVGE-EKLRNATTRYLVRHIYSTATTEDYL----------- 575
            :.:...|   ||.||...|..|..|.|: ::..:....|:.::.:::...:|.|           
Human   434 SHLMNLF---TYEKGYCFVYYLSQLCGDPQRFDDFLRAYVEKYKFTSVVAQDLLDSFLSFFPELK 495

  Fly   576 -TAVEEEEGLEFDVKQIMQTWTEQMGLPVVEVEKS-GSTYKLTQ------KRFLANEDDYAAEAE 632
             .:|:...||||      :.|....|.|:.|.:.| ||:  ||:      :.:.|...|.|| |.
Human   496 EQSVDCRAGLEF------ERWLNATGPPLAEPDLSQGSS--LTRPVEALFQLWTAEPLDQAA-AS 551

  Fly   633 ASSFNY-RW------------------------SIPITYTS---SINSEVQ 655
            ||:.:. :|                        |:...|:|   |:|:|::
Human   552 ASAIDISKWRTFQTALFLDRLLDGSPLPQEVVMSLSKCYSSLLDSMNAEIR 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32473NP_731787.1 Peptidase_M1 143..537 CDD:279741 101/453 (22%)
M1_APN_2 151..602 CDD:189008 115/523 (22%)
ERAP1_C 677..992 CDD:288671
RNPEPL1NP_060696.4 M1_LTA4H 29..512 CDD:341062 120/538 (22%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:P15144 326..330 2/3 (67%)
Leuk-A4-hydro_C 560..673 CDD:401171 7/43 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 676..699
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.