DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8774 and Rnpepl1

DIOPT Version :9

Sequence 1:NP_650274.2 Gene:CG8774 / 41635 FlyBaseID:FBgn0038136 Length:942 Species:Drosophila melanogaster
Sequence 2:NP_852070.3 Gene:Rnpepl1 / 108657 MGIID:1914170 Length:720 Species:Mus musculus


Alignment Length:463 Identity:114/463 - (24%)
Similarity:186/463 - (40%) Gaps:104/463 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 RQAFPCFDEPAMKATFAITVVHPSGSYHAVSNMQQTESNYLGDYTEAIFETSVSMSTYLVCIIVS 259
            |..|||||.||:|.|::..|..|.|   ....|..|:|.|:.:.....|.....:..|||.::..
Mouse   198 RSFFPCFDTPAVKCTYSAVVKAPLG---VQVLMSATQSVYVEEEGLYHFHMEHPVPAYLVALVAG 259

  Fly   260 DFASQSTTVKANGIGEDFSMQA------YATSHQINKVEFALEFGQAVTEYYIQYYKVPYPLTKL 318
            |       :|...||....:.|      .|||.....||   ::..|....|     .||...:.
Mouse   260 D-------LKPADIGPRSRVWAEPCLLPTATSKLSGAVE---QWLSAAERLY-----GPYMWGRY 309

  Fly   319 DMAAI-PDFASGAMEHWGLVTYRETALLYDPSYSSTANKQSIAGTLAHEIAHQWFGNLVTMKWWN 382
            |:..: |.|...|||: ..:|:..:::|....:        :...:.||:||.||||.||...|.
Mouse   310 DIVFLPPSFPIVAMEN-PCLTFIISSILESDEF--------LVIDVIHEVAHSWFGNAVTNATWE 365

  Fly   383 DLWLNEGFARYMQYK-----------------GVNAVHPDWGMLEQFQIVALQPVLLYDAKLSSH 430
            ::||:||.|.|.|.:                 .::|:|....:|.:.     .||.....||  .
Mouse   366 EMWLSEGLATYAQRRITTETYGAAFTCLETAFRLDALHRQMRLLGED-----SPVSKLQVKL--E 423

  Fly   431 PIVQKVESPDEITAIFDTISYEKGGSVIRMLETLVGA-EKFEEAVTNYLVKHQFNNTVTDD---- 490
            |.|    :|..:..:|   :||||...:..|..|.|. ::|::.:..|:.|::|.:.|..|    
Mouse   424 PGV----NPSHLMNLF---TYEKGYCFVYYLSQLCGGPQRFDDFLRAYVEKYKFTSVVAQDLLDS 481

  Fly   491 ---FLTEVEAVVTD----LDIKKLMLTWTEQMGYPVLNVSKVADGSFKVTQ------QRFLSNPA 542
               |..|::....|    |:.::    |....| |.|....::.|| .:|:      |.:.:.|.
Mouse   482 FLSFFPELKEQSVDCRAGLEFER----WLNATG-PPLAEPDLSQGS-SLTRPVEALFQLWTAEPL 540

  Fly   543 SYEEAPSDSAYGYKW-SVPITWFAD---DGS--------ENSFIYDYDVDSVGIAVPSEVQWIKL 595
            ....|.:.:....|| :.....|.|   |||        ..|..|...:||:...:  .::|:::
Mouse   541 EQAAASASAIDISKWRTFQTALFLDRLLDGSPLPQEVVMSLSKCYSSLLDSMNAEI--RIRWLQI 603

  Fly   596 NVNQTGYY 603
             |.:..||
Mouse   604 -VVRNDYY 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8774NP_650274.2 Peptidase_M1 67..454 CDD:279741 74/282 (26%)
M1_APN_2 75..518 CDD:189008 91/358 (25%)
ERAP1_C 593..910 CDD:288671 3/11 (27%)
Rnpepl1NP_852070.3 M1_LTA4H 29..507 CDD:189006 90/353 (25%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:P15144 321..325 2/3 (67%)
Leuk-A4-hydro_C 524..668 CDD:312599 19/90 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 671..708
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.