DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8773 and Aopep

DIOPT Version :9

Sequence 1:NP_650273.2 Gene:CG8773 / 41634 FlyBaseID:FBgn0038135 Length:994 Species:Drosophila melanogaster
Sequence 2:XP_008769651.1 Gene:Aopep / 290963 RGDID:1309592 Length:886 Species:Rattus norvegicus


Alignment Length:450 Identity:86/450 - (19%)
Similarity:154/450 - (34%) Gaps:147/450 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 SSSYVKEDETRKWIATSKFEPTYARQAFPCFDEPALKAEFTIT-------LVHPSGE-------- 280
            |.::..:.:.|..:.|.. .|...|..|||.:.|...:.:..|       :|..|||        
  Rat   320 SVTWTSDQDGRPCVYTMG-SPINNRALFPCQEPPVAMSTWQATVRAAASFVVLMSGEKSAKPTPL 383

  Fly   281 -----DYHALSNMNVDSS---VSQGAFQEVTFAKSVPMSTYLACFIV-----SDFAYKQVSIDTK 332
                 .:|....|.:.:|   ::.|.:.|:. .|:.|:.......:.     :||.|        
  Rat   384 REGYMSWHYYVTMPMPASTFTIAVGCWTEMK-PKTSPLDDLTEHTLPLRPSDADFRY-------- 439

  Fly   333 GIGETFSMSVYATPEQLDKVDLAVTIGKGVIEYYIDYFQI------------------------- 372
              |.|.|...|  |.:......|.   :.:|.|.: :..:                         
  Rat   440 --GNTCSHMEY--PCRFQSASAAT---QNIIPYRV-FAPVCLEGACREALLWLIPSCLSAAHSVL 496

  Fly   373 -AYPLPKLDMAAIP-DFVSGAMEHWGLVTYRETSLLYDEATSSATNKQRIASV-IAHEFAHMWFG 434
             .:|..:||:..:| :|.|..|....::...:::|         |....:... :.||.||.|||
  Rat   497 GTHPFSRLDILIVPTNFPSLGMASPHIIFLSQSTL---------TGTSHLCGTRLCHEIAHAWFG 552

  Fly   435 NLVTMNWWNDLWLNEGFASFVEYLGVDAVYPE--------------------W-KMRDQFTVS-- 476
            ..:....|.:.||:||||:.:|    |..:.|                    | :::|:...|  
  Rat   553 LAIGARDWTEEWLSEGFATHLE----DIFWAEAQQLPPHEALEQQELRACLRWHRLQDELQNSPE 613

  Fly   477 -----------TLHSVLTLDGTLGSHPIIQTVENPDQITEIFDTITYSKGSSLVRMLEDFLGETT 530
                       |.|  ::..|.    .:::...||:   :.|..:.|.||..|:|.|...|||.|
  Rat   614 GMQVLRPNKEKTGH--VSASGA----SVVKNGLNPE---KGFMQVHYLKGYFLLRFLARTLGEET 669

  Fly   531 FRQAVTNYLNEYKYSTAETGNFFTEIDKLEL-----------GYNVTEIMLTWTVQMGLP 579
            :...:..:::.:.      |......|.|::           |.:|..|:..|....|:|
  Rat   670 YFPFLRKFVHLFH------GQLILSQDFLQMLLESIPENKRFGLSVENIVGDWLECPGIP 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8773NP_650273.2 Peptidase_M1 122..515 CDD:279741 68/373 (18%)
M1_APN_2 130..579 CDD:189008 85/448 (19%)
ERAP1_C 655..969 CDD:288671
AopepXP_008769651.1 GluZincin 250..697 CDD:301352 80/422 (19%)
Leuk-A4-hydro_C 743..884 CDD:286244
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.