DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8773 and LOC1273453

DIOPT Version :10

Sequence 1:NP_650273.2 Gene:CG8773 / 41634 FlyBaseID:FBgn0038135 Length:994 Species:Drosophila melanogaster
Sequence 2:XP_312430.6 Gene:LOC1273453 / 1273453 VectorBaseID:AGAMI1_008821 Length:1057 Species:Anopheles gambiae


Alignment Length:40 Identity:11/40 - (27%)
Similarity:21/40 - (52%) Gaps:9/40 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 EECPLPEQSLQQIHDVQIHY-------QEISNAKLYIEQN 290
            ::|.|.|..:.|:||  .||       |:.::.:.:|.:|
Mosquito   417 KKCELVEVDVAQLHD--CHYDGCEKRFQKTTDLEYHISKN 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8773NP_650273.2 KLF9_13_N-like <17..118 CDD:425361
M1_APN-Q_like 130..573 CDD:341064 11/40 (28%)
ERAP1_C 654..973 CDD:463368
LOC1273453XP_312430.6 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.