DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and Wnt16

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_444346.3 Gene:Wnt16 / 93735 MGIID:2136018 Length:364 Species:Mus musculus


Alignment Length:311 Identity:77/311 - (24%)
Similarity:131/311 - (42%) Gaps:63/311 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KGLKQALDSCQQSFQWQRWNC--PSQDFVQKNSKP----EENSPNREDVYVAAISMAAIVHTLTK 100
            :|.:..:..|:..|:.:||||  .:....|..:.|    |.:|..:|..::.||..|.:||::|:
Mouse    72 EGARLGIQECRSQFRHERWNCMVATTTSTQLATAPLFGYELSSGTKETAFIYAIMAAGLVHSVTR 136

  Fly   101 DCANGVIAGCGCTENALNVPCAHEPTKALEQYEKHFGSGSGAI-------------------GHN 146
            .|:.|.:..|.|.....|   ...|::..     |:|..|..:                   |..
Mouse   137 SCSAGNMTECSCDTTLQN---GGSPSEGW-----HWGGCSDDVQYGMWFSRKFLDLPIRNTTGKE 193

  Fly   147 RRVVGAL-----------LQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDA 200
            .||:.|:           :.:.:..:|||.   .|.|.|..:.|...:..||.|...|...|:::
Mouse   194 SRVLLAMNLHNNEAGRQAVAKLMSVDCRCH---GVSGSCAVKTCWKTMSSFEKIGHFLKDKYENS 255

  Fly   201 IQLEGASSNLKIM-----WQNIPL--DSLVFMQDSPNYC-ERDATGLWKGTRGRQCSKDGSGSLE 257
            ||:...:.. |:.     .:..|:  |.|:::..||||| |....|: .||:||:|::...|:  
Mouse   256 IQISDKTKR-KMRRREKDQRQTPILKDDLLYVHKSPNYCVENKKLGI-PGTQGRECNRTSGGA-- 316

  Fly   258 ERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308
              ..|..||  ||....:..||...||.||.:|...::|..|..:...::|
Mouse   317 --DGCNLLC--CGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVHTC 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 76/309 (25%)
Wnt16NP_444346.3 wnt 52..364 CDD:278536 77/311 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.