DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and WNT5B

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_024304971.1 Gene:WNT5B / 81029 HGNCID:16265 Length:411 Species:Homo sapiens


Alignment Length:304 Identity:83/304 - (27%)
Similarity:129/304 - (42%) Gaps:54/304 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GKGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKDCANG 105
            |:|.|..:..||..|:.:||||.:.|......:..:.. :||..:..|:|.|.:|:.:::.|..|
Human   125 GEGAKTGIKECQHQFRQRRWNCSTADNASVFGRVMQIG-SRETAFTHAVSAAGVVNAISRACREG 188

  Fly   106 VIAGCGCTENAL---------------NVPCAHEPTKAL---EQYEKHFGSGSGAIGH------- 145
            .::.|||:..|.               ||...:...|..   .:.||:|..||...|.       
Human   189 ELSTCGCSRTARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRVLMNLQN 253

  Fly   146 ---NRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAI------ 201
               .||.|    .:..:..|:|.   .|.|.|..:.|...|..|..:...|.:.||.|.      
Human   254 NEAGRRAV----YKMADVACKCH---GVSGSCSLKTCWLQLAEFRKVGDRLKEKYDSAAAMRVTR 311

  Fly   202 --QLEGASSNLKIMWQNIPLDSLVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEERLSCQQ 264
              :||..:|...   |..|.| ||::..||:||.|:.:....||:||.|:|...|    ...|:.
Human   312 KGRLELVNSRFT---QPTPED-LVYVDPSPDYCLRNESTGSLGTQGRLCNKTSEG----MDGCEL 368

  Fly   265 LCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308
            :|...||. :.:.|:.| ||:||..|...::|..|.::..||.|
Human   369 MCCGRGYN-QFKSVQVE-RCHCKFHWCCFVRCKKCTEIVDQYIC 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 82/302 (27%)
WNT5BXP_024304971.1 wnt 102..411 CDD:306592 83/304 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.