DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and wnt11f2

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001138276.1 Gene:wnt11f2 / 791595 ZFINID:ZDB-GENE-990603-12 Length:353 Species:Danio rerio


Alignment Length:294 Identity:82/294 - (27%)
Similarity:120/294 - (40%) Gaps:54/294 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKDCANGVIAGCGC-- 112
            :|..||...||||.|.:.. .:..|:.....||..:|.:::.|.:.|.:.:.||:|.:..|.|  
Zfish    78 ACTSSFSDMRWNCSSIESA-PHFTPDLAKGTREAAFVFSLAAAVVSHAIARACASGDLPSCSCAA 141

  Fly   113 --TENALNVP------CAHEPTKALEQYE-------KHFGSGSGAIG----HNRRVVGALLQRSL 158
              :|.|  .|      |.......|:...       ::..||..|..    ||..|...:|..||
Zfish   142 MPSEQA--APDFRWGGCGDNLRYGLQMGSAFSDAPIRNRRSGPQAFRLMQLHNNAVGRQVLMDSL 204

  Fly   159 EQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAI-----------QLEGASSNLKI 212
            |.:|:|.   .|.|.|..:.|...|:....|:.||...|..|.           ||......::.
Zfish   205 EMKCKCH---GVSGSCSVKTCWKGLQDISTISADLKSKYLSATKVIPRQIGTRRQLVPREMEVRP 266

  Fly   213 MWQNIPLDSLVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVCGYRVRSQH 277
            :.:|    .||::..||:||.::|.....||..|||:|..|||    .||..:|  ||   |..:
Zfish   267 VGEN----ELVYLVSSPDYCTQNAKQGSLGTTDRQCNKTASGS----ESCGLMC--CG---RGYN 318

  Fly   278 VRTE---RRCNCKLVWGFRLQCDVCVQLERQYSC 308
            ..||   .||.||..|...:.|..|.:...:|.|
Zfish   319 AYTEVLVERCQCKYHWCCYVSCKTCKRTVERYVC 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 81/292 (28%)
wnt11f2NP_001138276.1 wnt 50..353 CDD:278536 82/294 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.