DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and wnt10b

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001072771.1 Gene:wnt10b / 780228 XenbaseID:XB-GENE-482664 Length:388 Species:Xenopus tropicalis


Alignment Length:326 Identity:71/326 - (21%)
Similarity:128/326 - (39%) Gaps:76/326 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DITG---KGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENS----PNREDVYVAAISMAAIV 95
            |:|.   :|::.|:..||...:.|||||.:.:.:.|  .|.:::    ..||..:..::..|.::
 Frog    65 DVTASALQGIQIAIHECQHQLKGQRWNCSTLETMGK--MPHDSAILKRGFRESAFAFSLLAAGVM 127

  Fly    96 HTLTKDCANGVIAGCGC------TENALNVP---------------------------------- 120
            |::...|:.|.:.||||      ||..:.:.                                  
 Frog   128 HSVATACSLGKLQGCGCEWKRRGTEEKIRLKLNQLQLQALSKVKGLPRDLTPLLRETPEPSPQDT 192

  Fly   121 -----CAHEPTKALEQYEKHFGSGSGAIG--------HNRRVVGALLQRSLEQECRCKQPGAVQG 172
                 |.|| .:..|::.:.|.....:..        ||.||....:..::::.|:|.   ...|
 Frog   193 WEWGGCKHE-LEFGEKFSRDFLDSRESPRDIHARMRIHNNRVGRQAVTENMKRRCKCH---GTSG 253

  Fly   173 ECQEEECVAVLKPFEAIAQDLLQMYDDAIQLEGASSNLKIMWQNIP----LDSLVFMQDSPNYCE 233
            .||.:.|..|...|.|:...:......|:.:...:.|.......:.    ...||:.:.||::||
 Frog   254 SCQFKTCWHVTPDFRAVGTLMRDKLQRAVFVNSRNKNSGAFHPRLNKKRLAKELVYFEKSPDFCE 318

  Fly   234 RDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDV 298
            :|......||:||.|:|    :.::..:|..||...|:.:..|..|  .||||:..|...:.|:.
 Frog   319 KDPRVDSPGTQGRVCNK----TSQQMDNCASLCCGRGHNILMQTRR--ERCNCRFHWCCYVMCEE 377

  Fly   299 C 299
            |
 Frog   378 C 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 69/323 (21%)
wnt10bNP_001072771.1 wnt 52..388 CDD:278536 71/326 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.