DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and WNT2B

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_078613.1 Gene:WNT2B / 7482 HGNCID:12781 Length:391 Species:Homo sapiens


Alignment Length:305 Identity:79/305 - (25%)
Similarity:124/305 - (40%) Gaps:59/305 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GKGLKQALDSCQQSFQWQRWNCPSQD-------FVQKNSKPEENSPNREDVYVAAISMAAIVHTL 98
            |:|.::.:..||..|:..||||.:.|       .|...|       :||..:|.|||.|.:||.:
Human    97 GEGAREWIRECQHQFRHHRWNCTTLDRDHTVFGRVMLRS-------SREAAFVYAISSAGVVHAI 154

  Fly    99 TKDCANGVIAGC--------------------GCTENALNVPCAHEPTKALEQY----EKHFGSG 139
            |:.|:.|.::.|                    ||::|      .|...:..:.:    ||.....
Human   155 TRACSQGELSVCSCDPYTRGRHHDQRGDFDWGGCSDN------IHYGVRFAKAFVDAKEKRLKDA 213

  Fly   140 SGAIG-HNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQL 203
            ...:. ||.|.....::|.|:.||:|.   .|.|.|....|...|..|......|.:.||.|:|:
Human   214 RALMNLHNNRCGRTAVRRFLKLECKCH---GVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQV 275

  Fly   204 ----EGAS-SNLKIMWQNIPLDSLVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEERLSCQ 263
                :||: :..:..::......||:..:||:||..|......||.||.|||...|:    ..|:
Human   276 MATQDGANFTAARQGYRRATRTDLVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGT----DGCE 336

  Fly   264 QLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308
            .:|  ||....:..|....:|.||..|...::|..|......::|
Human   337 IMC--CGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVDVHTC 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 78/303 (26%)
WNT2BNP_078613.1 wnt 74..380 CDD:306592 79/305 (26%)
WNT-core domain 107..379 76/293 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.