DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and WNT11

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_011543540.1 Gene:WNT11 / 7481 HGNCID:12776 Length:364 Species:Homo sapiens


Alignment Length:310 Identity:83/310 - (26%)
Similarity:129/310 - (41%) Gaps:66/310 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KQALDSCQQSFQWQRWNCPSQDF-------VQKNSK--PEENSPNREDVYVAAISMAAIVHTLTK 100
            ::.:.:|:::|...||||.|.:.       :::.|.  |...|..||..:|.|:|.|||.|.:.:
Human    74 REVMKACRRAFADMRWNCSSIELAPNYLLDLERASADLPLPPSGTRESAFVYALSAAAISHAIAR 138

  Fly   101 DCANGVIAGC-----------------GCTEN-----ALNVPCAHEPTKALEQYEKHFGSGSGAI 143
            .|.:|.:.||                 ||.:|     .:....:..|.|.     |..||.:..:
Human   139 ACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKV-----KKTGSQANKL 198

  Fly   144 G--HNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQL--- 203
            .  ||..|....|:.|||.:|:|.   .|.|.|....|...|:..:.:|.||...|..|.::   
Human   199 MRLHNSEVGRQALRASLEMKCKCH---GVSGSCSIRTCWKGLQELQDVAADLKTRYLSATKVVHR 260

  Fly   204 -EGASSNLKIMWQNIPLD---------SLVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEE 258
             .|...:|      :|.|         .||::|.||::|.::......||:.|||:|..:||   
Human   261 PMGTRKHL------VPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCNKTSNGS--- 316

  Fly   259 RLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308
             .||..:|  ||........|...||:||..|...:.|..|.:...:|.|
Human   317 -DSCDLMC--CGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVC 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 82/308 (27%)
WNT11XP_011543540.1 wnt 47..364 CDD:302926 83/310 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.