DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and WNT10B

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_003385.2 Gene:WNT10B / 7480 HGNCID:12775 Length:389 Species:Homo sapiens


Alignment Length:335 Identity:81/335 - (24%)
Similarity:123/335 - (36%) Gaps:95/335 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DITG---KGLKQALDSCQQSFQWQRWNC---------PSQDFVQKNSKPEENSPNREDVYVAAIS 90
            |:|.   :||..|:..||...:.|||||         |....:.|..       .||..:..::.
Human    67 DVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRG-------FRESAFSFSML 124

  Fly    91 MAAIVHTLTKDCANGVIAGCGC--------------------------TENALNVP--------- 120
            .|.::|.:...|:.|.:..|||                          ..::|..|         
Human   125 AAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSPGPGSSPSPG 189

  Fly   121 ---------CAHEPTKALEQYEKHFGSGSGAIG--------HNRRVVGALLQRSLEQECRCKQPG 168
                     |.|:.... |::.:.|.....|..        ||.||...::..:|:::|:|.   
Human   190 PQDTWEWGGCNHDMDFG-EKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVTENLKRKCKCH--- 250

  Fly   169 AVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQLEGASSNLKIMWQNIP----LDSLVFMQDSP 229
            ...|.||.:.|......|.|:...|.:....||.::..:.|.......:.    ...||:.:.||
Human   251 GTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLRPRRLSGELVYFEKSP 315

  Fly   230 NYCERDATGLWKGTRGRQCSK-----DGSGSLEERLSCQQLCRVCGYRVRSQHVRTERRCNCKLV 289
            ::||||.|....|||||.|:|     ||.||         ||...|:.|..| .|.| ||:|:..
Human   316 DFCERDPTMGSPGTRGRACNKTSRLLDGCGS---------LCCGRGHNVLRQ-TRVE-RCHCRFH 369

  Fly   290 WGFRLQCDVC 299
            |...:.||.|
Human   370 WCCYVLCDEC 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 79/332 (24%)
WNT10BNP_003385.2 Wnt_Wnt10b 45..389 CDD:381730 81/335 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..197 2/25 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.