DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and WNT8A

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_016865313.1 Gene:WNT8A / 7478 HGNCID:12788 Length:408 Species:Homo sapiens


Alignment Length:332 Identity:89/332 - (26%)
Similarity:155/332 - (46%) Gaps:56/332 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IFAITFFMGITSTLAAVLEPMSYYQYTQFQAPLSWEDITGKGLKQALDSCQQSFQWQRWNCPSQD 66
            :|.||:  .:.:.|  :..|.:|..||...|         .|.:..::.|:..|.|:||||| ::
Human    58 VFRITW--SVNNFL--ITGPKAYLTYTTSVA---------LGAQSGIEECKFQFAWERWNCP-EN 108

  Fly    67 FVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKDCANGVIAGCGC--TENAL------------ 117
            .:|.::.....|..||..::.|||.|.:::.:||:|:.|....|||  :.|..            
Human   109 ALQLSTHNRLRSATRETSFIHAISSAGVMYIITKNCSMGDFENCGCDGSNNGKTGGHGWIWGGCS 173

  Fly   118 -NVPCAHEPTKA-LEQYEKHFGSGSGAIG--HNRRVVGALLQRSLEQECRCKQPGAVQGECQEEE 178
             ||......:|. ::..||  |..:.|:.  ||.|.....::.::::.|:|.   .:.|.|..:.
Human   174 DNVEFGERISKLFVDSLEK--GKDARALMNLHNNRAGRLAVRATMKRTCKCH---GISGSCSIQT 233

  Fly   179 CVAVLKPFEAIAQDLLQMYDDAIQLE------GASSNLKIMWQNIPLDS--------LVFMQDSP 229
            |...|..|..:...|...||.|:::|      .|.::.:..|  :|.::        |:|:::||
Human   234 CWLQLAEFREMGDYLKAKYDQALKIEMDKRQLRAGNSAEGHW--VPAEAFLPSAEAELIFLEESP 296

  Fly   230 NYCE-RDATGLWKGTRGRQCSKDG-SGSLEERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGF 292
            :||. ..:.|:: ||.||:|.::. :.|..||.||.:||..||.:|..:.......||||..|..
Human   297 DYCTCNSSLGIY-GTEGRECLQNSHNTSRWERRSCGRLCTECGLQVEERKTEVISSCNCKFQWCC 360

  Fly   293 RLQCDVC 299
            .::||.|
Human   361 TVKCDQC 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 80/293 (27%)
WNT8AXP_016865313.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 1 1.010 - - D278331at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12027
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.