DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and WNT3

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_110380.1 Gene:WNT3 / 7473 HGNCID:12782 Length:355 Species:Homo sapiens


Alignment Length:337 Identity:88/337 - (26%)
Similarity:133/337 - (39%) Gaps:70/337 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QYTQF-QAPLSWEDITG--------------------KGLKQALDSCQQSFQWQRWNCPSQDFVQ 69
            |||.. ..||....|.|                    :|:|..:..||..|:.:||||.:.|...
Human    34 QYTSLGSQPLLCGSIPGLVPKQLRFCRNYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSL 98

  Fly    70 KNSKPEENSPNREDVYVAAISMAAIVHTLTKDCANG--VIAGC---------------GCTENA- 116
            ....|..:...||..:|.||:.|.:...:|:.||.|  .|.||               ||:|:| 
Human    99 AIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDAD 163

  Fly   117 LNVPCAHEPTKALEQYEKHFGSGSGAIGHNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVA 181
            ..|..:.|...|.|...   .:.|....||.......:...:..:|:|.   .:.|.|:.:.|..
Human   164 FGVLVSREFADARENRP---DARSAMNKHNNEAGRTTILDHMHLKCKCH---GLSGSCEVKTCWW 222

  Fly   182 VLKPFEAIAQDLLQMYDDAIQL--------EGASSNLKIMWQ--NIPLD-SLVFMQDSPNYCE-R 234
            ....|.||...|...||.|.::        .|....|:..:.  ..|.: .||:.::|||:|| .
Human   223 AQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRAKYSLFKPPTERDLVYYENSPNFCEPN 287

  Fly   235 DATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVCGYRVRSQHVRTERR---CNCKLVWGFRLQC 296
            ..||.: |||.|.|:....| ::   .|..||  ||   |..:.|||:|   |:|...|...:.|
Human   288 PETGSF-GTRDRTCNVTSHG-ID---GCDLLC--CG---RGHNTRTEKRKEKCHCIFHWCCYVSC 342

  Fly   297 DVCVQLERQYSC 308
            ..|:::...::|
Human   343 QECIRIYDVHTC 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 81/319 (25%)
WNT3NP_110380.1 Wnt_Wnt3_Wnt3a 42..355 CDD:381709 85/329 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.