DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and Wnt5a

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_006252726.1 Gene:Wnt5a / 64566 RGDID:69250 Length:391 Species:Rattus norvegicus


Alignment Length:298 Identity:80/298 - (26%)
Similarity:131/298 - (43%) Gaps:42/298 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GKGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKDCANG 105
            |:|.|..:..||..|:.:||||.:.|......:..:.. :||..:..|:|.|.:|:.:::.|..|
  Rat   105 GEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIG-SRETAFTYAVSAAGVVNAMSRACREG 168

  Fly   106 VIAGCGCTENA--LNVP-------C----------AHEPTKALEQYEKHFGSGSGAIG------H 145
            .::.|||:..|  .::|       |          |.|...|.|: |:....||....      |
  Rat   169 ELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARER-ERIHAKGSYESARILMNLH 232

  Fly   146 NRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQLEGASSNL 210
            |.......:....:..|:|.   .|.|.|..:.|...|..|..:...|.:.||.|..:. .:|..
  Rat   233 NNEAGRRTVYNLADVACKCH---GVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMR-LNSRG 293

  Fly   211 KIMWQNIPLDS-----LVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVCG 270
            |::..|...:|     ||::..||:||.|:.:....||:||.|:|...|    ...|:.:|...|
  Rat   294 KLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEG----MDGCELMCCGRG 354

  Fly   271 YRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308
            |. :.:.|:|| ||:||..|...::|..|.::..|:.|
  Rat   355 YD-QFKTVQTE-RCHCKFHWCCYVKCKKCTEIVDQFVC 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 79/296 (27%)
Wnt5aXP_006252726.1 Wnt_Wnt5a 80..391 CDD:381721 80/298 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.