DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and wnt3

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001108024.1 Gene:wnt3 / 569420 ZFINID:ZDB-GENE-081003-1 Length:355 Species:Danio rerio


Alignment Length:301 Identity:78/301 - (25%)
Similarity:123/301 - (40%) Gaps:51/301 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KGLKQALDSCQQSFQWQRWNCPSQDFVQKNS----KPEENSPNREDVYVAAISMAAIVHTLTKDC 102
            :|:|..:..||..|:.:||||.:    .|:|    .|..:...||..:|.||:.|.:...:|:.|
Zfish    71 EGVKLGIQECQHQFRGRRWNCTT----IKDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSC 131

  Fly   103 ANGVIAGCGCTENALNVP--------CAHE-------PTKALEQYEKHFGSGSGAIGHNRRVVGA 152
            |.|....|||..:....|        |:.:       ..:..:..|....:.|....||......
Zfish   132 AEGTSTMCGCDSHHKGPPGEGWKWGGCSEDAEFGVLVSREFADARENRPDARSAMNRHNNEAGRM 196

  Fly   153 LLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQL--------EGASSN 209
            .:..::...|:|.   .:.|.|:.:.|......|..:...|...||.|.::        .|....
Zfish   197 TILENMHLRCKCH---GLSGSCEVKTCWWAQPDFRLLGDYLKDKYDSASEMVVEKHRESRGWVET 258

  Fly   210 L--KIMWQNIPLD-SLVFMQDSPNYCE-RDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVCG 270
            |  |..:...|.: .||:.:.|||:|| ...||.: |||.|.|:....| :|   .|..||  ||
Zfish   259 LRAKYAFFKHPTERDLVYYEGSPNFCEPNPETGSF-GTRDRACNVSSHG-IE---GCDLLC--CG 316

  Fly   271 YRVRSQHVRTERR---CNCKLVWGFRLQCDVCVQLERQYSC 308
               |..:.|||:|   |:|...|...:.|..||::...::|
Zfish   317 ---RGHNTRTEKRKEKCHCIFHWCCYVSCQECVRVYDVHTC 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 77/299 (26%)
wnt3NP_001108024.1 WNT1 47..355 CDD:128408 78/301 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.