DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and wnt2bb

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001037809.1 Gene:wnt2bb / 556087 ZFINID:ZDB-GENE-060824-6 Length:396 Species:Danio rerio


Alignment Length:316 Identity:80/316 - (25%)
Similarity:128/316 - (40%) Gaps:81/316 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GKGLKQALDSCQQSFQWQRWNCPSQD--------FVQKNSKPEENSPNREDVYVAAISMAAIVHT 97
            |.|.|:.:..||..|:..||||.:.|        .:|::|        ||..:|.|||.|.:|..
Zfish   102 GGGAKEWIRECQYQFRHHRWNCSALDRDHTVFGRVIQRSS--------REAAFVYAISSAGVVFA 158

  Fly    98 LTKDCANGVIAGCGCTENALNVPCAHEPTK----ALEQYEKHFGSGSGAIG-------------- 144
            :|:.|:.|.:..|.|           :|.|    :.|:.|..:|..|..|.              
Zfish   159 ITRACSQGELKACNC-----------DPQKRGRASDERGEFDWGGCSDNINYGIKFAKAFIDAKE 212

  Fly   145 ------------HNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMY 197
                        ||.|.....::|.::.||:|.   .|.|.|....|...:..|......|.:.|
Zfish   213 RTVKDARALMNLHNNRCGRMAVKRFMKLECKCH---GVSGSCTLRTCWLAMSDFRKTGDYLRKKY 274

  Fly   198 DDAIQL----EG-----ASSNLKIMWQNIPLDSLVFMQDSPNYCERDATGLWKGTRGRQCSKDGS 253
            :.||::    :|     |:.:.:...:|    .||:.::||:||..|.|....||.||.|:|...
Zfish   275 NGAIEVTMNQDGTGFTVANKDFRKATKN----DLVYFENSPDYCLMDKTAGSLGTAGRVCNKTSR 335

  Fly   254 GSLEERLSCQQLCRVCGY-RVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308
            |:    ..|:.:|...|| ..||:.:   .:|.||..|...::|..|.:....::|
Zfish   336 GT----DGCEVMCCGRGYDTTRSKRI---TKCECKFKWCCTVECKDCEEAVDIHTC 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 79/314 (25%)
wnt2bbNP_001037809.1 wnt 83..385 CDD:278536 80/316 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.