DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and wnt8-2

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001018637.2 Gene:wnt8-2 / 553976 -ID:- Length:354 Species:Danio rerio


Alignment Length:334 Identity:90/334 - (26%)
Similarity:151/334 - (45%) Gaps:50/334 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MGITSTLAAVL--EPMSYYQYTQFQAPLSWEDITGKGLKQALDSCQQSFQWQRWNCPSQDFVQKN 71
            :|.|.|:..:|  .|.:|         |::.:....|.:..:..|:..|.|.||||| ...:|.:
Zfish    19 LGHTWTMNNLLITGPKAY---------LTYANSVRVGAQSGIHECKHQFAWDRWNCP-DTALQLS 73

  Fly    72 SKPEENSPNREDVYVAAISMAAIVHTLTKDCANGVIAGCGCTEN---------------ALNVPC 121
            :.....|..||..:|.|||.|.:::|||::|:.|.:..|||..:               :.||..
Zfish    74 THKGLRSATRESSFVHAISAAGVMYTLTRNCSLGDLNECGCDSSRNGRLGGRGWLWGGCSDNVDF 138

  Fly   122 AHEPTKALEQYEKHFGSGSGAIG----HNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAV 182
            ....:|   |:.....:|..|..    ||.......::.::::.|||.   .:...|..:.|...
Zfish   139 GERISK---QFVDALETGQDARAAVNLHNNEAGRLAVKATMKRICRCH---GMSESCTMQTCWMQ 197

  Fly   183 LKPFEAIAQDLLQMYDDAIQLE--------GASSNLKI----MWQNIPLDSLVFMQDSPNYCERD 235
            |..|..|...|...:|.|.:||        |.|::.::    .:.:|....|::::|||:||.::
Zfish   198 LADFREIGNYLKVKHDQAQKLEMDKRRMRAGNSADNRVTMTDAFGSIARTELIYLEDSPDYCAKN 262

  Fly   236 ATGLWKGTRGRQCSKDG-SGSLEERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVC 299
            .:....||.||:|.:.| |.|..||.||::||..||.||..:.......||||..|...::|:.|
Zfish   263 LSLGLPGTEGRECVQHGESLSQWERRSCRRLCHECGLRVEERRTEVVSSCNCKFHWCCTVKCENC 327

  Fly   300 VQLERQYSC 308
            .|:..::.|
Zfish   328 SQVTVKHVC 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 82/298 (28%)
wnt8-2NP_001018637.2 WNT1 23..336 CDD:128408 87/328 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D278331at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.