DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and WNT4

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_011539899.1 Gene:WNT4 / 54361 HGNCID:12783 Length:373 Species:Homo sapiens


Alignment Length:307 Identity:82/307 - (26%)
Similarity:131/307 - (42%) Gaps:57/307 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DITGKGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKDC 102
            |...:|.:.|::.||..|:.:||||.:.|.:....|..... .||..:|.|||.|.:...:|:.|
Human    87 DSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQG-TREAAFVYAISSAGVAFAVTRAC 150

  Fly   103 ANGVIAGCGCTENALNVP--------CAHE-------PTKALEQYEKHFG-SGSGAIG--HNRRV 149
            ::|.:..|||......|.        |:..       ....::..|:..| |.|.|:.  ||...
Human   151 SSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNEA 215

  Fly   150 VGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQLE----GASSNL 210
            ....:...:..||:|.   .|.|.|:.:.|...:.||..:...|.:.:|.|.::|    |:|..|
Human   216 GRKAILTHMRVECKCH---GVSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRRVGSSRAL 277

  Fly   211 KIMWQNIPL---------DSLVFMQDSPNYCERDATGLWKGTRGRQCSK-----DGSGSLEERLS 261
                  :|.         :.||:::.||::||:|......|||||.|:|     ||         
Human   278 ------VPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTSKAIDG--------- 327

  Fly   262 CQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308
            |:.||  ||....:..|....||:||..|...::|..|.:|...::|
Human   328 CELLC--CGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTC 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 80/302 (26%)
WNT4XP_011539899.1 wnt 71..373 CDD:278536 82/307 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.