DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and Wnt16

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001102693.1 Gene:Wnt16 / 500047 RGDID:1562253 Length:364 Species:Rattus norvegicus


Alignment Length:311 Identity:76/311 - (24%)
Similarity:126/311 - (40%) Gaps:63/311 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KGLKQALDSCQQSFQWQRWNC--PSQDFVQKNSKP----EENSPNREDVYVAAISMAAIVHTLTK 100
            :|.:..:..|:..|:.:||||  .:....|..:.|    |.:|..:|..::.||..|.:||::|:
  Rat    72 EGARLGIQECRSQFRHERWNCMVATATSTQLATAPLFGYELSSGTKETAFIYAIMAAGLVHSVTR 136

  Fly   101 DCANGVIAGCGCTENALNVPCAHEPTKALEQYEKHFGSGSGAIG--------------------- 144
            .|:.|.:..|.|.....|...|.|..        |:|..|..:.                     
  Rat   137 SCSAGNMTECSCDTTLQNSGSASEGW--------HWGGCSDDVQYGMWFSRKFLDLPVRNTTEKE 193

  Fly   145 ---------HNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDA 200
                     ||.......:.:.:..:|||.   .|.|.|..:.|...:..||.|...|...|:::
  Rat   194 SKVLLAMNLHNNEAGRQAVAKLMSVDCRCH---GVSGSCAVKTCWKTMSSFEKIGYFLKDKYENS 255

  Fly   201 IQLEGASSNLKIM-----WQNIPL--DSLVFMQDSPNYC-ERDATGLWKGTRGRQCSKDGSGSLE 257
            ||:...:.. |:.     .:..|:  |.|:::..||||| |....|: .||:||:|::...|:  
  Rat   256 IQISDKTKR-KMRRREKDQRQTPILKDDLLYVHKSPNYCVENKKLGI-PGTQGRECNRTSGGA-- 316

  Fly   258 ERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308
              ..|..||  ||....:..||...||.||.:|...::|..|..:...::|
  Rat   317 --DGCNLLC--CGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVHTC 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 75/309 (24%)
Wnt16NP_001102693.1 wnt 52..364 CDD:278536 76/311 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.