DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and Wnt10

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster


Alignment Length:405 Identity:91/405 - (22%)
Similarity:135/405 - (33%) Gaps:147/405 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TQFQAPLSWE--DITG---KGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENS----PNRED 83
            |:.|..|.::  |:|.   :||..|:..||..|||.||||.|  ...|:..|..:|    ..||.
  Fly    83 TKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSS--LSTKSRNPHASSLLKKGYRES 145

  Fly    84 VYVAAISMAAIVHTLTKDCANGVIAGCGC----------------------------TENALNVP 120
            .:..|||.|.:.|::.:.|:.|.:..|||                            ..|.:..|
  Fly   146 AFAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTP 210

  Fly   121 -------------------CAHEPTKALEQYEKHF-------GSGSGAIG-HNRRVVGALLQRSL 158
                               |:|.....:| |.|.|       |.....|. ||.......:..::
  Fly   211 EEEKKYERSKIASRWKWGGCSHNMDFGVE-YSKLFLDCREKAGDIQSKINLHNNHAGRIAVSNNM 274

  Fly   159 EQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQLE------------------- 204
            |..|:|.   .:.|.||.:.|......|..:.:.|...:..||.::                   
  Fly   275 EFRCKCH---GMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARNK 336

  Fly   205 -------------------------------------------------GASSNLKIMWQNIPLD 220
                                                             .|..|...|.:.:. .
  Fly   337 KSNGGSGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAARMARKLE-T 400

  Fly   221 SLVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVCGYRVRSQHV-RTERRC 284
            ||.:.|.|||:||||.....:||.||:|:::.:.|    ..|..||  || |..||.: |...||
  Fly   401 SLFYYQRSPNFCERDLGADIQGTVGRKCNRNTTTS----DGCTSLC--CG-RGHSQVIQRRAERC 458

  Fly   285 NCKLVWGFRLQCDVC 299
            :||..|...::|:.|
  Fly   459 HCKFQWCCNVECEEC 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 86/390 (22%)
Wnt10NP_609109.3 wnt 82..466 CDD:278536 89/396 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12027
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.