DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and Wnt4

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster


Alignment Length:303 Identity:76/303 - (25%)
Similarity:122/303 - (40%) Gaps:75/303 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKDCANGVIAGCG 111
            |...|::.|::.||||..:...::|.   .....:|..:|.|::.||:.|::.:.||.|.:..|.
  Fly   270 ATTHCEEQFRYDRWNCSIETRGKRNI---FKKLYKETAFVHALTAAAMTHSIARACAEGRMTKCS 331

  Fly   112 CTENALNVPCAHEPTKALEQYEKHFGSGSGAIGHNRRV--------------VGALLQRSLE--- 159
            |.      |..|.    .|..:..:|..:..:.|.:||              |..:|:...|   
  Fly   332 CG------PKKHN----REAQDFQWGGCNDNLKHGKRVTRSFLDLRGGDGDEVSEILRHDSEVGI 386

  Fly   160 --------QECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQ--------LEGASS 208
                    .:|:|.   .|.|.|..:.|...:..|.|.|..|.|.|::||:        .:.:||
  Fly   387 EAVSSQMMDKCKCH---GVSGSCSMKTCWKKMADFNATATLLRQKYNEAIRKAPNQRSMRQVSSS 448

  Fly   209 NLKIMWQ--NIPLDS----LVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCR 267
            .:|...|  ..|..|    |.:::.||:||        ..|:.|||....        :|..|| 
  Fly   449 RMKKPKQRRKKPQQSQYTTLYYLETSPSYC--------AVTKDRQCLHPD--------NCGTLC- 496

  Fly   268 VCGYRVRSQHVRTERRCNCKLVWG--FRLQCDVCVQLERQYSC 308
             ||....:|.|:...:|.|:...|  .:|.||.|.:||.:|.|
  Fly   497 -CGRGYTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFC 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 75/301 (25%)
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 76/303 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12027
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.