DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and Wnt5

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster


Alignment Length:444 Identity:78/444 - (17%)
Similarity:135/444 - (30%) Gaps:191/444 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KGLKQALDSCQQSFQWQRWNCPSQDFVQKNSK----PEENSPNREDVYVAAISMAAIVHTLTKDC 102
            :|.:.|:..||..|:.:||||.:     .|.:    |..:....|..::.|::.|.:...:.:.|
  Fly   574 RGARAAIQECQFQFKNRRWNCST-----TNDETVFGPMTSLAAPEMAFIHALAAATVTSFIARAC 633

  Fly   103 ANGVIAGCGCTE----------------------------------------------------- 114
            .:|.:|.|.|:.                                                     
  Fly   634 RDGQLASCSCSRGSRPKQLHDDWKWGGCGDNLEFAYKFATDFIDSREKETNRETRGVKRKREEIN 698

  Fly   115 ---------NALNVPC------------------AHEPTKA------LEQYEKH----------- 135
                     ||.|:..                  ..:.|:|      .|.:::|           
  Fly   699 KNRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRNVRKSTEAENSHILNENFDQHLLELEQRITKE 763

  Fly   136 --------------------------FGSG---------------SGAIGHNRRVV------GAL 153
                                      |..|               :.|..:.|..:      |.:
  Fly   764 ILTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKKKRKNQRAAADAPAYPRNGIKESYKDGGI 828

  Fly   154 LQRSLEQ-------------------------ECRCKQPGAVQGECQEEECVAVLKPFEAIAQDL 193
            |.||...                         .|:|.   .|.|.|....|...|.....|...|
  Fly   829 LPRSTATVKARSLMNLHNNEAGRRAVIKKARITCKCH---GVSGSCSLITCWQQLSSIREIGDYL 890

  Fly   194 LQMYDDAIQL---EGASSNLKIMWQNIP-LDSLVFMQDSPNYCERDATGLWKGTRGRQCSKDGSG 254
            .:.|:.|.::   :.....:|.:...:| ...|:::.:||::|.......|.||.||.|.|:.||
  Fly   891 REKYEGATKVKINKRGRLQIKDLQFKVPTAHDLIYLDESPDWCRNSYALHWPGTHGRVCHKNSSG 955

  Fly   255 SLEERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308
             ||   ||..||  ||....::::....|||||..|..:::|:||.::..:::|
  Fly   956 -LE---SCAILC--CGRGYNTKNIIVNERCNCKFHWCCQVKCEVCTKVLEEHTC 1003

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 77/442 (17%)
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 78/444 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12027
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.